SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribo...    93   1e-19
At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) simi...    93   1e-19
At1g06230.2 68414.m00659 DNA-binding bromodomain-containing prot...    29   2.0  
At1g06230.1 68414.m00658 DNA-binding bromodomain-containing prot...    29   2.0  
At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to ...    29   2.6  

>At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B)
           ribosomal protein S23, Fragaria x ananassa, PIR:S56673
          Length = 142

 Score = 92.7 bits (220), Expect = 1e-19
 Identities = 42/48 (87%), Positives = 47/48 (97%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 95  ENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142



 Score = 87.0 bits (206), Expect = 7e-18
 Identities = 38/48 (79%), Positives = 43/48 (89%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IE+
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEE 95


>At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) similar
           to 40S ribosomal protein S23 (S12) GB:P46297 from
           [Fragaria x ananassa]
          Length = 142

 Score = 92.7 bits (220), Expect = 1e-19
 Identities = 42/48 (87%), Positives = 47/48 (97%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 95  ENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142



 Score = 87.0 bits (206), Expect = 7e-18
 Identities = 38/48 (79%), Positives = 43/48 (89%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IE+
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEE 95


>At1g06230.2 68414.m00659 DNA-binding bromodomain-containing protein
           contains bromodomain, INTERPRO:IPR001487
          Length = 766

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = +1

Query: 370 TPTF-SRGGP-VPIRPIVSRITIHWPSFYNRRDWENPGVTPT 489
           TPT  SR GP +P  PI  R TI    + NR+    PG TPT
Sbjct: 542 TPTMRSRLGPTMPPPPINVRNTIDRADWSNRQPTTTPGRTPT 583


>At1g06230.1 68414.m00658 DNA-binding bromodomain-containing protein
           contains bromodomain, INTERPRO:IPR001487
          Length = 766

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = +1

Query: 370 TPTF-SRGGP-VPIRPIVSRITIHWPSFYNRRDWENPGVTPT 489
           TPT  SR GP +P  PI  R TI    + NR+    PG TPT
Sbjct: 542 TPTMRSRLGPTMPPPPINVRNTIDRADWSNRQPTTTPGRTPT 583


>At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to
           MtN3 GI:1619602 (root nodule development) from [Medicago
           truncatula]
          Length = 289

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 12/39 (30%), Positives = 23/39 (58%)
 Frame = -1

Query: 177 VVKVANVSLLALYKEKKERPRS*VYIVISDLLSGSALFI 61
           VV++  +SL   Y  KKE+  +  +++  D+L   A+F+
Sbjct: 80  VVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFV 118


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,644,563
Number of Sequences: 28952
Number of extensions: 242905
Number of successful extensions: 535
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 525
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 535
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 987020800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).