SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g10290.1 68414.m01159 dynamin-like protein 6 (ADL6) identical...    40   5e-04
At1g59610.1 68414.m06704 dynamin-like protein, putative (ADL3) s...    40   6e-04
At2g30880.2 68415.m03764 pleckstrin homology (PH) domain-contain...    35   0.023
At2g30880.1 68415.m03763 pleckstrin homology (PH) domain-contain...    35   0.023
At5g05710.1 68418.m00628 pleckstrin homology (PH) domain-contain...    34   0.040
At5g61980.1 68418.m07779 ARF GTPase-activating domain-containing...    33   0.091
At1g60860.1 68414.m06851 ARF GTPase-activating domain-containing...    32   0.12 
At4g10320.1 68417.m01697 isoleucyl-tRNA synthetase, putative / i...    30   0.49 
At2g29700.1 68415.m03610 pleckstrin homology (PH) domain-contain...    30   0.64 
At1g10870.1 68414.m01249 ARF GTPase-activating domain-containing...    30   0.64 
At4g22540.1 68417.m03253 oxysterol-binding family protein simila...    28   2.0  
At1g77730.1 68414.m09050 pleckstrin homology (PH) domain-contain...    28   2.0  
At4g12460.1 68417.m01971 oxysterol-binding family protein simila...    28   2.6  
At2g31020.1 68415.m03782 oxysterol-binding family protein simila...    28   2.6  
At4g08180.3 68417.m01353 oxysterol-binding family protein simila...    27   6.0  
At4g08180.2 68417.m01352 oxysterol-binding family protein simila...    27   6.0  
At4g08180.1 68417.m01351 oxysterol-binding family protein simila...    27   6.0  
At4g00315.1 68417.m00040 F-box family protein contains F-box dom...    26   7.9  
At1g66170.1 68414.m07511 PHD finger family protein (MMD1) contai...    26   7.9  

>At1g10290.1 68414.m01159 dynamin-like protein 6 (ADL6) identical to
           dynamin-like protein 6 (ADL6) [Arabidopsis thaliana]
           GI:6651399; contains Pfam profiles PF01031: Dynamin
           central region, PF00350: Dynamin family, PF02212:
           Dynamin GTPase effector domain, PF00169: PH domain
          Length = 914

 Score = 40.3 bits (90), Expect = 5e-04
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G+L K+ A   GW +RWFVL+    +L Y    E+ + +G I L E
Sbjct: 577 GYLMKKSAKTNGWSRRWFVLNEKTGKLGYTKKQEERNFRGTITLEE 622


>At1g59610.1 68414.m06704 dynamin-like protein, putative (ADL3)
           strong similarity to dynamin-like protein 6 (ADL6)
           [Arabidopsis thaliana] GI:6651399; contains Pfam
           profiles PF01031: Dynamin central region, PF00350:
           Dynamin family, PF02212: Dynamin GTPase effector domain,
           PF00169: PH domain; identical to cDNA dynamin-like
           protein ADL3,  GI:4803835
          Length = 920

 Score = 39.9 bits (89), Expect = 6e-04
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G+L K+ A   GW +RWFVL+    +L Y    E+ + +G + L E
Sbjct: 584 GYLMKKSAKTNGWSRRWFVLNEKTGKLGYTKKQEERNFRGTVTLEE 629


>At2g30880.2 68415.m03764 pleckstrin homology (PH) domain-containing
           protein contains Pfam profile PF00169: PH domain
          Length = 381

 Score = 34.7 bits (76), Expect = 0.023
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G L+KR   L+ W +RW +LD    ++ Y     +   KG I
Sbjct: 35  QGPLFKRSETLRKWNERWVILDPTTGKMEYKTRRNEPTIKGTI 77


>At2g30880.1 68415.m03763 pleckstrin homology (PH) domain-containing
           protein contains Pfam profile PF00169: PH domain
          Length = 504

 Score = 34.7 bits (76), Expect = 0.023
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G L+KR   L+ W +RW +LD    ++ Y     +   KG I
Sbjct: 35  QGPLFKRSETLRKWNERWVILDPTTGKMEYKTRRNEPTIKGTI 77


>At5g05710.1 68418.m00628 pleckstrin homology (PH) domain-containing
           protein similar to AtPH1 [Arabidopsis thaliana]
           GI:5926716; contains Pfam profile PF00169: PH domain
          Length = 144

 Score = 33.9 bits (74), Expect = 0.040
 Identities = 25/82 (30%), Positives = 37/82 (45%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+G  +K W++RWFVL   K  L ++   +DS          V+ V     A G  
Sbjct: 32  GWLTKQGEYIKTWRRRWFVLKQGK--LFWF---KDSDVTRVSRPRGVVPVESCLTAKGAE 86

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
              + ++ F+L T   T  F A
Sbjct: 87  DVLNKQNAFELSTRNETMYFIA 108


>At5g61980.1 68418.m07779 ARF GTPase-activating domain-containing
           protein similar to GCN4-complementing protein (GCP1)
           GI:6465806 from [Arabidopsis thaliana]
          Length = 850

 Score = 32.7 bits (71), Expect = 0.091
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +G+L KR + L+G WK+R+F+LDS +  L YY
Sbjct: 314 QGYLSKRSSNLRGDWKRRFFILDS-RGMLYYY 344


>At1g60860.1 68414.m06851 ARF GTPase-activating domain-containing
           protein
          Length = 776

 Score = 32.3 bits (70), Expect = 0.12
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +E   +G+L KR A L+  WK+R+FVLD+  H   YY
Sbjct: 289 KEVTKQGYLLKRSASLRADWKRRFFVLDN--HGSLYY 323


>At4g10320.1 68417.m01697 isoleucyl-tRNA synthetase, putative /
            isoleucine--tRNA ligase, putative similar to SP|P41252
            Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5)
            (Isoleucine--tRNA ligase) (IleRS) (IRS) {Homo sapiens};
            contains Pfam profile PF00133: tRNA synthetases class I
            (I, L, M and V)
          Length = 1190

 Score = 30.3 bits (65), Expect = 0.49
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +1

Query: 133  ILYSASLPSHRSIVADVLSSPTRTIFVSIP*VERLACRDALVRSVL 270
            +L S+ +PSH  I+AD   +P  T   S+  V +L+ + +L R  L
Sbjct: 1068 LLLSSLMPSHAVIIADETFTPKETSDESVKKVPKLSYKISLARPAL 1113


>At2g29700.1 68415.m03610 pleckstrin homology (PH) domain-containing
           protein (PH1) identical to AtPH1 [Arabidopsis thaliana]
           GI:5926716; contains Pfam profile PF00169: PH domain
          Length = 145

 Score = 29.9 bits (64), Expect = 0.64
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G L K+G  +K W++RWFVL
Sbjct: 31  GWLTKQGDYIKTWRRRWFVL 50


>At1g10870.1 68414.m01249 ARF GTPase-activating domain-containing
           protein 
          Length = 775

 Score = 29.9 bits (64), Expect = 0.64
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLK-GWKQRWFVLDSIKHQLRYY 164
           +E   +G+L KR + L+  WK+++FVLDS  H   YY
Sbjct: 287 KEVIKQGYLLKRSSSLRTDWKRKFFVLDS--HGSMYY 321


>At4g22540.1 68417.m03253 oxysterol-binding family protein similar
           to SP|P16258 Oxysterol-binding protein 1 {Oryctolagus
           cuniculus}; contains Pfam profiles PF00169: PH domain,
           PF01237: Oxysterol-binding protein
          Length = 721

 Score = 28.3 bits (60), Expect = 2.0
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVL 194
           +   G LYK     KGW+ RWF+L
Sbjct: 51  ETVAGILYKWTNFGKGWRSRWFLL 74


>At1g77730.1 68414.m09050 pleckstrin homology (PH) domain-containing
           protein similar to SP|P16258 Oxysterol-binding protein 1
           {Oryctolagus cuniculus}; contains Pfam profile PF00169:
           PH domain
          Length = 265

 Score = 28.3 bits (60), Expect = 2.0
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G LYK     +GWK+RWFVL
Sbjct: 56  GILYKWVNYGQGWKRRWFVL 75


>At4g12460.1 68417.m01971 oxysterol-binding family protein similar
           to SP|P22059 Oxysterol-binding protein 1 {Homo sapiens};
           contains Pfam profiles PF00169: PH domain, PF01237:
           Oxysterol-binding protein
          Length = 694

 Score = 27.9 bits (59), Expect = 2.6
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVL 194
           ++  G LYK     KGW+ RWF+L
Sbjct: 26  RSVAGILYKWTNYGKGWRSRWFLL 49


>At2g31020.1 68415.m03782 oxysterol-binding family protein similar
           to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens};
           contains Pfam profiles PF00169: PH domain, PF01237:
           Oxysterol-binding protein
          Length = 760

 Score = 27.9 bits (59), Expect = 2.6
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G LYK     KGW+ RWFVL
Sbjct: 75  GILYKWVNYGKGWRPRWFVL 94


>At4g08180.3 68417.m01353 oxysterol-binding family protein similar
           to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens};
           contains Pfam profiles PF00169: PH domain, PF01237:
           Oxysterol-binding protein
          Length = 813

 Score = 26.6 bits (56), Expect = 6.0
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G LYK     +GW+ RWFVL
Sbjct: 108 GILYKWVNYGRGWRPRWFVL 127



 Score = 26.6 bits (56), Expect = 6.0
 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 4/29 (13%)
 Frame = -3

Query: 223 KGWKQRWFV----LDSIKHQLRYYDAMED 149
           +GWK RWF+     +S +++  Y++A ED
Sbjct: 764 RGWKPRWFMKEKGSESYRYKGGYWEARED 792


>At4g08180.2 68417.m01352 oxysterol-binding family protein similar
           to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens};
           contains Pfam profiles PF00169: PH domain, PF01237:
           Oxysterol-binding protein
          Length = 813

 Score = 26.6 bits (56), Expect = 6.0
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G LYK     +GW+ RWFVL
Sbjct: 108 GILYKWVNYGRGWRPRWFVL 127



 Score = 26.6 bits (56), Expect = 6.0
 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 4/29 (13%)
 Frame = -3

Query: 223 KGWKQRWFV----LDSIKHQLRYYDAMED 149
           +GWK RWF+     +S +++  Y++A ED
Sbjct: 764 RGWKPRWFMKEKGSESYRYKGGYWEARED 792


>At4g08180.1 68417.m01351 oxysterol-binding family protein similar
           to SP|Q969R2 Oxysterol-binding protein 2 {Homo sapiens};
           contains Pfam profiles PF00169: PH domain, PF01237:
           Oxysterol-binding protein
          Length = 814

 Score = 26.6 bits (56), Expect = 6.0
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G LYK     +GW+ RWFVL
Sbjct: 108 GILYKWVNYGRGWRPRWFVL 127



 Score = 26.6 bits (56), Expect = 6.0
 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 4/29 (13%)
 Frame = -3

Query: 223 KGWKQRWFV----LDSIKHQLRYYDAMED 149
           +GWK RWF+     +S +++  Y++A ED
Sbjct: 765 RGWKPRWFMKEKGSESYRYKGGYWEARED 793


>At4g00315.1 68417.m00040 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 441

 Score = 26.2 bits (55), Expect = 7.9
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           WK  W  L  +++  R+Y   E      FI L+
Sbjct: 34  WKSLWMWLPKLEYDFRHYSVSEGQGLARFITLS 66


>At1g66170.1 68414.m07511 PHD finger family protein (MMD1) contains
           Pfam profile: PF00628: PHD-finger
          Length = 704

 Score = 26.2 bits (55), Expect = 7.9
 Identities = 11/35 (31%), Positives = 17/35 (48%)
 Frame = -3

Query: 187 IKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAP 83
           I    RYY  M + H K F DL   + + ++  +P
Sbjct: 255 INQVFRYYREMSEGHLKTFRDLLRFMLIIKSHASP 289


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,038,089
Number of Sequences: 28952
Number of extensions: 126347
Number of successful extensions: 378
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 377
length of database: 12,070,560
effective HSP length: 73
effective length of database: 9,957,064
effective search space used: 567552648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).