SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   221   3e-58
At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   221   3e-58
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   220   4e-58
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   220   4e-58
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   220   5e-58
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   220   5e-58
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   215   1e-56
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   215   1e-56
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   215   1e-56
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   206   9e-54
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   157   4e-39
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   128   2e-30
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   115   2e-26
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    97   6e-21
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    89   2e-18
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    77   5e-15
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    62   2e-10
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    54   5e-08
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    44   6e-05
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.062
At2g22330.1 68415.m02649 cytochrome P450, putative similar to cy...    32   0.25 
At1g16690.2 68414.m01999 transcription factor-related similar to...    28   4.1  
At1g16690.1 68414.m01998 transcription factor-related similar to...    28   4.1  
At5g06610.1 68418.m00747 expressed protein contains Pfam profile...    27   5.4  
At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein si...    27   5.4  
At4g26670.1 68417.m03842 mitochondrial import inner membrane tra...    27   7.1  
At2g25680.1 68415.m03078 expressed protein ; expression supporte...    27   7.1  
At5g13500.3 68418.m01559 expressed protein predicted protein At2...    27   9.4  
At5g13500.2 68418.m01558 expressed protein predicted protein At2...    27   9.4  
At5g13500.1 68418.m01557 expressed protein predicted protein At2...    27   9.4  
At4g14746.1 68417.m02269 expressed protein                             27   9.4  
At3g05750.1 68416.m00646 expressed protein                             27   9.4  
At1g63020.1 68414.m07117 DNA-directed RNA polymerase alpha subun...    27   9.4  

>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  221 bits (539), Expect = 3e-58
 Identities = 99/112 (88%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  221 bits (539), Expect = 3e-58
 Identities = 99/112 (88%), Positives = 105/112 (93%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  220 bits (538), Expect = 4e-58
 Identities = 99/112 (88%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  220 bits (538), Expect = 4e-58
 Identities = 99/112 (88%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 116


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  220 bits (537), Expect = 5e-58
 Identities = 98/112 (87%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKA 116


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  220 bits (537), Expect = 5e-58
 Identities = 98/112 (87%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGD  +SKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKA 116


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  215 bits (526), Expect = 1e-56
 Identities = 93/112 (83%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGD  +SKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKA 116


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  215 bits (526), Expect = 1e-56
 Identities = 93/112 (83%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGD  +SKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKA 116


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  215 bits (526), Expect = 1e-56
 Identities = 93/112 (83%), Positives = 104/112 (92%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGD  +SKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           GILTLKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKA
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKA 116


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  206 bits (502), Expect = 9e-54
 Identities = 90/121 (74%), Positives = 108/121 (89%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGD  +++R
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQARR 65

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQ 451
           GIL+LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEAPLNPK + R +  Q
Sbjct: 66  GILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPK-VNREKMTQ 124

Query: 452 I 454
           I
Sbjct: 125 I 125


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  157 bits (381), Expect = 4e-39
 Identities = 72/107 (67%), Positives = 83/107 (77%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG+   + R ILTL
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHANRDILTL 58

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           K P+EHGIV NWDDMEKIWH+TFYNELRV PEEHPVLLTEAP NPKA
Sbjct: 59  KDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHPVLLTEAPYNPKA 105


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  128 bits (310), Expect = 2e-30
 Identities = 54/71 (76%), Positives = 64/71 (90%)
 Frame = +2

Query: 215 MVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 394
           MVGM + D +VGD  +++ GILTL YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPV
Sbjct: 1   MVGMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPV 60

Query: 395 LLTEAPLNPKA 427
           LLTEAPLNPKA
Sbjct: 61  LLTEAPLNPKA 71


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  115 bits (277), Expect = 2e-26
 Identities = 51/107 (47%), Positives = 71/107 (66%), Gaps = 2/107 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG+     R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGETCSELRHQL 66

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            + YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+ PLNP
Sbjct: 67  DINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNP 113


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 97.1 bits (231), Expect = 6e-21
 Identities = 53/125 (42%), Positives = 73/125 (58%), Gaps = 16/125 (12%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---GMGQKDSYVGDGHK 262
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG     G+ +       +D+   D  K
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKESDKEK 64

Query: 263 SKRGILT-------------LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 403
            KR + T             +  P + GIVT+WD ++ +W H F N L + P EHP+LL 
Sbjct: 65  GKRKLYTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHPMLLA 124

Query: 404 EAPLN 418
           E PLN
Sbjct: 125 EPPLN 129


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 88.6 bits (210), Expect = 2e-18
 Identities = 54/131 (41%), Positives = 73/131 (55%), Gaps = 22/131 (16%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM--------VGMGQKDSYV 247
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G       M             +DS  
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKT 64

Query: 248 -GDGHKSKR----GILTLKY---------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 385
             +  KSKR    G   + Y         PI+ GIV++WD ++ IW H F + L + P E
Sbjct: 65  ESEKEKSKRKLYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTE 124

Query: 386 HPVLLTEAPLN 418
           HP+LL E PLN
Sbjct: 125 HPMLLAEPPLN 135


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 77.4 bits (182), Expect = 5e-15
 Identities = 50/127 (39%), Positives = 67/127 (52%), Gaps = 21/127 (16%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-----------------RPRHQ-GVMVGMG 229
           A+V+DNG+G  K GFAG+  P  + P++V                  + +H  GV   + 
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSKSSSKATWQTQHNAGVAADL- 66

Query: 230 QKDSYVGDGHKSK-RGILT--LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 400
             D Y+GD   +K R   T  L YPIEHG V +WD ME+ W    +N LR  PE+H  LL
Sbjct: 67  --DFYIGDEALAKSRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLL 124

Query: 401 TEAPLNP 421
           TE+PL P
Sbjct: 125 TESPLTP 131


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 34/110 (30%), Positives = 56/110 (50%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG G+ KAG  G+  P  V P+ + +P      +      +   +   +   +   
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTTLSDEIDLTSAAV--- 61

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQR 436
           + PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  ++QR
Sbjct: 62  RRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQR 111


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 54.0 bits (124), Expect = 5e-08
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD   S       
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGDLDPSMMKYFDC 77

Query: 287 -----KYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNP 421
                + P +  +V  ++ ME I  + F       +  +HP+L+TE   NP
Sbjct: 78  TRSGPRSPFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNP 128


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 44.0 bits (99), Expect = 6e-05
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 2/114 (1%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           ALVVD GS   KAG A  D +P  + PS + R      MV  G   +   D   +    +
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR------MVDDGSSSA---DNPTTVFEDV 53

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPKALQRR 439
           TL  PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA++ +
Sbjct: 54  TLD-PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQ 106


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.062
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -2

Query: 228 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 91
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At2g22330.1 68415.m02649 cytochrome P450, putative similar to
           cytochrome P450 79B2 (SP:O81346) [Arabidopsis thaliana]
          Length = 543

 Score = 31.9 bits (69), Expect = 0.25
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -1

Query: 331 HVIPVSDDSVFDGVFEGQDTSFALVPISYIRVLLSH 224
           HVIPV+   +   +F+ QD  FA  P++Y + +LS+
Sbjct: 104 HVIPVTCPKIAREIFKQQDALFASRPLTYAQKILSN 139


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +2

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 379
           L++KY + H I + W +  +IW       L+  P
Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP 211


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +2

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 379
           L++KY + H I + W +  +IW       L+  P
Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP 211


>At5g06610.1 68418.m00747 expressed protein contains Pfam profile
           PF04788: Protein of unknown function (DUF620)
          Length = 368

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 204 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 82
           WR  P +  + A+GA  P + AL   +PL+ ++  +S+  +
Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207


>At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein
           similar to lysosomal alpha-mannosidase GI:3522867 from
           [Homo sapiens]
          Length = 1019

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = -1

Query: 325 IPVSDDSVFDGVFEGQDTSFALVPISYIRVLLSHTDHHALMAGPSHDRGKH 173
           +PVS ++V      G++  F L+P+S I + + +    A +     D  KH
Sbjct: 505 VPVSSENVIVKDASGKEVVFQLLPLSEIALRIRNEYVKAYLGRSPRDTAKH 555


>At4g26670.1 68417.m03842 mitochondrial import inner membrane
           translocase subunit Tim17/Tim22/Tim23 family protein
           weak similarity to SP|Q9Z0V8 Mitochondrial import inner
           membrane translocase subunit TIM17 A {Mus musculus};
           contains Pfam profile PF02466: Mitochondrial import
           inner membrane translocase subunit Tim17
          Length = 210

 Score = 27.1 bits (57), Expect = 7.1
 Identities = 20/55 (36%), Positives = 24/55 (43%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           ALV      +C   FAGD A  AV  SI G     G+    G K S+   G  +K
Sbjct: 37  ALVTIPAPAVCLFRFAGDAAGGAVMGSIFG--YGSGLFKKKGFKGSFADAGQSAK 89


>At2g25680.1 68415.m03078 expressed protein ; expression supported
           by MPSS
          Length = 456

 Score = 27.1 bits (57), Expect = 7.1
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = -1

Query: 391 GVFLGGDTQLI-VEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALVPISYIR 239
           G+  GG   ++ + G+M  + ++IP+S   V  G+   Q  +FA+  + YIR
Sbjct: 114 GICTGGILFVLGISGLMQLVFNIIPLS---VVRGIQLSQGLAFAMSAVKYIR 162


>At5g13500.3 68418.m01559 expressed protein predicted protein
           At2g25260 - Arabidopsis thaliana, EMBL:AC007070
          Length = 358

 Score = 26.6 bits (56), Expect = 9.4
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (5%)
 Frame = -1

Query: 391 GVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALV--PISYIRVLLSHT- 221
           G  +GG T+++  G   NL+  IP     V D +  G D  + ++  P ++++ L   T 
Sbjct: 94  GSDMGGFTRILHSGNSDNLMDEIPT---FVVDPLPPGLDRGYVVLNRPWAFVQWLERATI 150

Query: 220 -DHHALMAGPSH 188
            + + LMA P H
Sbjct: 151 KEDYVLMAEPDH 162


>At5g13500.2 68418.m01558 expressed protein predicted protein
           At2g25260 - Arabidopsis thaliana, EMBL:AC007070
          Length = 358

 Score = 26.6 bits (56), Expect = 9.4
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (5%)
 Frame = -1

Query: 391 GVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALV--PISYIRVLLSHT- 221
           G  +GG T+++  G   NL+  IP     V D +  G D  + ++  P ++++ L   T 
Sbjct: 94  GSDMGGFTRILHSGNSDNLMDEIPT---FVVDPLPPGLDRGYVVLNRPWAFVQWLERATI 150

Query: 220 -DHHALMAGPSH 188
            + + LMA P H
Sbjct: 151 KEDYVLMAEPDH 162


>At5g13500.1 68418.m01557 expressed protein predicted protein
           At2g25260 - Arabidopsis thaliana, EMBL:AC007070
          Length = 358

 Score = 26.6 bits (56), Expect = 9.4
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (5%)
 Frame = -1

Query: 391 GVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALV--PISYIRVLLSHT- 221
           G  +GG T+++  G   NL+  IP     V D +  G D  + ++  P ++++ L   T 
Sbjct: 94  GSDMGGFTRILHSGNSDNLMDEIPT---FVVDPLPPGLDRGYVVLNRPWAFVQWLERATI 150

Query: 220 -DHHALMAGPSH 188
            + + LMA P H
Sbjct: 151 KEDYVLMAEPDH 162


>At4g14746.1 68417.m02269 expressed protein
          Length = 250

 Score = 26.6 bits (56), Expect = 9.4
 Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 7/61 (11%)
 Frame = +3

Query: 330 WRRFGIIPSTMSCVSPPRNTPSCLLRLPSTPRPYRGEDDPRFMVRKQ-------FNTPRH 488
           W++F      + C++P  N    +   P+ P+P   ++   F  RK        F+ PRH
Sbjct: 56  WKQFDQHLKFLPCITPNCNISPLITASPAQPKPPPKDNITSFFDRKSLISFFLCFSGPRH 115

Query: 489 V 491
           +
Sbjct: 116 I 116


>At3g05750.1 68416.m00646 expressed protein
          Length = 798

 Score = 26.6 bits (56), Expect = 9.4
 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 3/85 (3%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDGHKSK 268
           ++V  ++V+NG+   K GF    A ++   S+  +    +      G +++ V    + K
Sbjct: 386 KKVNKVLVENGTTTKKPGFTATSAKKSTSSSLSRKKNLSRSKKPANGVQEAGVNSDKRIK 445

Query: 269 RG--ILTLKYPIEHGIVTNWDDMEK 337
           +G  ++     ++ G+ T  DD +K
Sbjct: 446 KGEKVIKCNITVDGGLKTGDDDRKK 470


>At1g63020.1 68414.m07117 DNA-directed RNA polymerase alpha subunit
           family protein low similarity to RNA polymerase IIA
           largest subunit [Trypanosoma brucei] GI:162215; contains
           InterPro accession IPR000722: RNA polymerase, alpha
           subunit
          Length = 1453

 Score = 26.6 bits (56), Expect = 9.4
 Identities = 18/62 (29%), Positives = 25/62 (40%)
 Frame = +2

Query: 113 VDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKY 292
           + N +   K      +AP  V  S +G P    V    G KD  V +GH    G++   Y
Sbjct: 22  ISNNNDRDKMSVLEVEAPNQVTDSRLGLPNPDSVCRTCGSKDRKVCEGH---FGVINFAY 78

Query: 293 PI 298
            I
Sbjct: 79  SI 80


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,304,701
Number of Sequences: 28952
Number of extensions: 296434
Number of successful extensions: 951
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 854
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 945
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 888318720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).