SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0017
         (477 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g32240.1 68414.m03966 myb family transcription factor (KAN2) ...    30   0.70 
At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR...    29   1.6  
At3g21950.1 68416.m02769 S-adenosyl-L-methionine:carboxyl methyl...    27   6.6  
At3g03750.2 68416.m00381 SET domain-containing protein low simil...    27   8.7  
At3g03750.1 68416.m00380 SET domain-containing protein low simil...    27   8.7  

>At1g32240.1 68414.m03966 myb family transcription factor (KAN2)
           contains Pfam profile: PF00249 myb-like DNA-binding
           domain; identical to cDNA GARP-like putative
           transcription factor KANADI2 (KAN2)  GI:15723594
          Length = 388

 Score = 30.3 bits (65), Expect = 0.70
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -1

Query: 177 NSTGKPELTGEKNCNNSRNST*VN*HECFHEKENRSKF 64
           +ST  P LTG  N  N+ + +  N H   H+  NR++F
Sbjct: 164 SSTSSPALTGNNNSFNTSSVSNPNYHNHHHQTLNRARF 201


>At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1189

 Score = 29.1 bits (62), Expect = 1.6
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 3/41 (7%)
 Frame = +3

Query: 60  NQISNGF---LFHENIRVNLLKCCYVSCYSFSLQLTQVFQS 173
           NQ+S+ F   +F ENI+ N  +      YS  LQL Q+F S
Sbjct: 279 NQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMS 319


>At3g21950.1 68416.m02769 S-adenosyl-L-methionine:carboxyl
           methyltransferase family protein similar to
           SAM:salicylic acid carboxyl methyltransferase (SAMT)
           [GI:6002712][Clarkia breweri] and to SAM:benzoic acid
           carboxyl methyltransferase
           (BAMT)[GI:9789277][Antirrhinum majus]
          Length = 335

 Score = 27.1 bits (57), Expect = 6.6
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
 Frame = +3

Query: 84  FHENIRVNLLKCCYVSCYSFSLQLTQVFQSSS--FSYNTKCLDY 209
           FHE +++N+   CYVS    S   T++F S S  F +++ CL +
Sbjct: 77  FHEKLKMNVKGNCYVSGCPGSF-YTRLFPSKSLHFVHSSFCLHW 119


>At3g03750.2 68416.m00381 SET domain-containing protein low
           similarity to G9a [Homo sapiens] GI:287865; contains
           Pfam profiles PF00856: SET domain, PF05033: Pre-SET
           motif
          Length = 354

 Score = 26.6 bits (56), Expect = 8.7
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = -3

Query: 346 KMAAVAANC----LLSESAIFQRSLDPTNLTPTLSVRTHNS 236
           ++A VA  C    L+S+S    RSLD       +S+  HNS
Sbjct: 43  ELAVVAQTCKTLSLISKSLTIHRSLDAARSLENISIPFHNS 83


>At3g03750.1 68416.m00380 SET domain-containing protein low
           similarity to G9a [Homo sapiens] GI:287865; contains
           Pfam profiles PF00856: SET domain, PF05033: Pre-SET
           motif
          Length = 338

 Score = 26.6 bits (56), Expect = 8.7
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = -3

Query: 346 KMAAVAANC----LLSESAIFQRSLDPTNLTPTLSVRTHNS 236
           ++A VA  C    L+S+S    RSLD       +S+  HNS
Sbjct: 43  ELAVVAQTCKTLSLISKSLTIHRSLDAARSLENISIPFHNS 83


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,644,679
Number of Sequences: 28952
Number of extensions: 180834
Number of successful extensions: 400
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 394
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 400
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 821630280
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).