SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g13550.1 68418.m01565 sulfate transporter family protein simi...    31   0.64 
At1g33700.1 68414.m04167 expressed protein contains Pfam domain ...    29   1.5  
At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative ...    29   2.0  
At5g49900.1 68418.m06179 expressed protein contains Pfam domain ...    28   3.4  
At2g03600.1 68415.m00320 hypothetical protein similar to SP|Q417...    28   3.4  
At1g10780.1 68414.m01235 F-box family protein  ; similar to SKP1...    28   4.5  
At5g56250.2 68418.m07020 expressed protein                             27   7.9  
At5g56250.1 68418.m07019 expressed protein                             27   7.9  
At3g51150.1 68416.m05601 kinesin motor family protein contains P...    27   7.9  

>At5g13550.1 68418.m01565 sulfate transporter family protein similar
           to sulfate transporter [Arabidopsis thaliana]
           GI:3777483; contains Pfam profiles PF00916: Sulfate
           transporter family, PF01740: STAS domain
          Length = 685

 Score = 30.7 bits (66), Expect = 0.64
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +1

Query: 232 YR*SIARYINK---VEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQL--STDHR 396
           Y  ++ +Y N+   V+ +   I +  P T +     + + EL    K    QL  S  ++
Sbjct: 552 YEVAVDKYTNRGLEVDRINFVILEMSPVTHIDSSAVEALKELYQEYKTRDIQLAISNPNK 611

Query: 397 ELHATVSKSGQV 432
           ++H T+++SG V
Sbjct: 612 DVHLTIARSGMV 623


>At1g33700.1 68414.m04167 expressed protein contains Pfam domain
           PF04685: Protein of unknown function, DUF608
          Length = 947

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -3

Query: 332 WACSGVNGVFGGCWAISRRSSSTL 261
           W+CSGV+   GG W  + ++ S L
Sbjct: 676 WSCSGVSAYCGGLWVAALQAGSAL 699


>At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative
           similar to GT-2 factor [Arabidopsis thaliana GI:416490
          Length = 619

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +1

Query: 268 EELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELH 405
           E++ R IA  PP  PL P Q      L   +  ++F  +T+H+  H
Sbjct: 8   EQIHRFIASPPPPPPLPPHQPAAERSLPFPVSFSSF--NTNHQPQH 51


>At5g49900.1 68418.m06179 expressed protein contains Pfam domain
           PF04685: Protein of unknown function, DUF608
          Length = 957

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -3

Query: 335 TWACSGVNGVFGGCWAISRRSSSTL 261
           TW+ SGV+   GG W  + +++S L
Sbjct: 682 TWSASGVSAYCGGLWVAALQAASAL 706


>At2g03600.1 68415.m00320 hypothetical protein similar to SP|Q41706
           A3 protein (unknown function) {Vigna unguiculata}
          Length = 344

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 121 FLKNTVGTGILKNNGFLYWG*AGFRQSNYKIY 216
           F  ++ G G++ N  FLYW   G  +S++K Y
Sbjct: 240 FSISSFGVGLILNIIFLYWPILGLPRSSFKAY 271


>At1g10780.1 68414.m01235 F-box family protein  ; similar to SKP1
           interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250
          Length = 418

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -2

Query: 468 LLHNRATKCLSIDLPTL*HCSMEF 397
           LL     K +SIDLP L HC ++F
Sbjct: 181 LLACEGVKSISIDLPYLEHCKLDF 204


>At5g56250.2 68418.m07020 expressed protein
          Length = 811

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = -3

Query: 347 NSLTTWACSGVNGVFGGCWAISRRSSSTLLIYLA 246
           NS+ +W   G + V G  WA+SR  S    +++A
Sbjct: 452 NSIGSWRVCGESQVSGKSWALSRNRSIESDLFVA 485


>At5g56250.1 68418.m07019 expressed protein
          Length = 811

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = -3

Query: 347 NSLTTWACSGVNGVFGGCWAISRRSSSTLLIYLA 246
           NS+ +W   G + V G  WA+SR  S    +++A
Sbjct: 452 NSIGSWRVCGESQVSGKSWALSRNRSIESDLFVA 485


>At3g51150.1 68416.m05601 kinesin motor family protein contains Pfam
           domain, PF00225: Kinesin motor domain
          Length = 1025

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 15/57 (26%), Positives = 29/57 (50%)
 Frame = +1

Query: 265 VEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVY 435
           V  L+RE+A+       +P QA VVS+  + +K+   Q+   ++E+     +  + Y
Sbjct: 357 VRHLQRELAKLESELS-SPRQALVVSDTTALLKEKDLQIEKLNKEVFQLAQELERAY 412


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,774,987
Number of Sequences: 28952
Number of extensions: 240801
Number of successful extensions: 581
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 567
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 581
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 987020800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).