SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g24030.1 68418.m02823 C4-dicarboxylate transporter/malic acid...    30   1.6  
At2g40980.1 68415.m05062 expressed protein                             29   2.7  
At3g11180.1 68416.m01357 oxidoreductase, 2OG-Fe(II) oxygenase fa...    28   6.3  

>At5g24030.1 68418.m02823 C4-dicarboxylate transporter/malic acid
           transport family protein weak similarity to SP|P25396
           Tellurite resistance protein tehA. {Escherichia coli};
           contains Pfam profile PF03595: C4-dicarboxylate
           transporter/malic acid transport protein
          Length = 635

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = -1

Query: 654 EVLPLESRYKAQVGPRVEVLLPIPGPGLPKYQLLPFAL-YRKEPFGLSI-IQSEIVL 490
           E +P++  Y A  GP +E L P     LP  +  PF L Y    FG+ + + S+ ++
Sbjct: 219 EAMPVDRYYDALEGPELETLRPQEEIVLPNDKKWPFLLRYPISTFGMCLGVSSQAIM 275


>At2g40980.1 68415.m05062 expressed protein 
          Length = 617

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = -3

Query: 616 RPSSGGTAPHPWARAPKIPATSI 548
           +PSSGG   HPW   P +  T +
Sbjct: 408 KPSSGGRCDHPWCGTPILVTTPV 430


>At3g11180.1 68416.m01357 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein similar to leucoanthocyanidin dioxygenase
           GB:BAA20143 [Perilla frutescens], Malus domestica,
           SP|P51091; contains PF03171 2OG-Fe(II) oxygenase
           superfamily domain
          Length = 400

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = -3

Query: 601 GTAPH--PWARAPKIPATSICSIQKRA--VWIVDNPIRDRFIIN 482
           G +PH  P      +P   +  +Q R    WI  NP+R  FI+N
Sbjct: 269 GLSPHSDPGGMTILLPDDQVVGLQVRHGDTWITVNPLRHAFIVN 312


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,103,232
Number of Sequences: 28952
Number of extensions: 288692
Number of successful extensions: 629
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 606
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 629
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1373722560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).