SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g56120.1 68416.m06237 Met-10+ like family protein non-consens...    29   1.8  
At3g60160.1 68416.m06717 ABC transporter family protein similar ...    27   7.1  
At1g07220.1 68414.m00768 expressed protein                             27   9.4  

>At3g56120.1 68416.m06237 Met-10+ like family protein non-consensus
           TT donor splice site at exon 4 ; contains Pfam profile
           PF02475: Met-10+ like-protein
          Length = 468

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = -3

Query: 249 ETQDLISQVTQEPNPEFNHLTSATTARENVQSFTSN*IKSPRT*QRALGTN*RGNELR 76
           +  DLI     +    F+HL + +T  +N+QS   N         R   TN  G E+R
Sbjct: 262 KVDDLICVHNMDARKFFSHLMAVSTCEDNLQSVADNDKTKEAAVSRGGETNSSGEEIR 319


>At3g60160.1 68416.m06717 ABC transporter family protein similar to
           ATP-binding cassette transporter MRP8 GI:18031899 from
           [Arabidopsis thaliana]
          Length = 1490

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -2

Query: 289 LSALLFMLTVLLRRDTGFNLTSHSG-TKP 206
           L A LF+L V +R  TGF+L   SG T+P
Sbjct: 188 LLASLFLLAVSIRGKTGFHLLESSGNTEP 216


>At1g07220.1 68414.m00768 expressed protein
          Length = 507

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = +3

Query: 495 RPVHEPDV--CYKTIHRPITPWATPQRSREHL 584
           R  H+P     ++ IHR + PWA    ++EH+
Sbjct: 108 RQTHQPQCPDFFRWIHRDLEPWAKTGVTKEHV 139


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,723,774
Number of Sequences: 28952
Number of extensions: 249245
Number of successful extensions: 522
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 503
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 522
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1180950720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).