SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribo...   101   5e-22
At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) simi...   101   5e-22
At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to ...    29   2.9  
At4g35335.1 68417.m05021 nucleotide-sugar transporter family pro...    28   5.1  
At2g38070.1 68415.m04673 expressed protein  and genscan                28   5.1  
At2g07675.1 68415.m00903 ribosomal protein S12 mitochondrial fam...    28   5.1  

>At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B)
           ribosomal protein S23, Fragaria x ananassa, PIR:S56673
          Length = 142

 Score =  101 bits (241), Expect = 5e-22
 Identities = 46/52 (88%), Positives = 51/52 (98%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 91  NYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGC
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGC 89


>At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) similar
           to 40S ribosomal protein S23 (S12) GB:P46297 from
           [Fragaria x ananassa]
          Length = 142

 Score =  101 bits (241), Expect = 5e-22
 Identities = 46/52 (88%), Positives = 51/52 (98%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 91  NYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGC
Sbjct: 48  GIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGC 89


>At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to
           MtN3 GI:1619602 (root nodule development) from [Medicago
           truncatula]
          Length = 289

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 12/39 (30%), Positives = 23/39 (58%)
 Frame = -3

Query: 163 VVKVANVSLLALYKEKKERPRS*VYIVISDLLSGSALFI 47
           VV++  +SL   Y  KKE+  +  +++  D+L   A+F+
Sbjct: 80  VVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFV 118


>At4g35335.1 68417.m05021 nucleotide-sugar transporter family
           protein similar to SP|O77592 UDP N-acetylglucosamine
           transporter (Golgi UDP-GlcNAc transporter) {Canis
           familiaris}, SP|P78382 CMP-sialic acid transporter {Homo
           sapiens}; contains Pfam profile PF04142:
           Nucleotide-sugar transporter
          Length = 302

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 4/64 (6%)
 Frame = +2

Query: 317 THLRMAELGCLASTP-TFSRGGPVXXXXXXXXXXXXLAVVLQRRD---WENPGVTQLNRL 484
           +++ MA LG  +S    + R G V            + +V  +R    W+N GVT  NRL
Sbjct: 46  SNIAMATLGVGSSERINWKRKGVVTCALTILTSSQAILIVWSKRAGKIWKNEGVTDDNRL 105

Query: 485 ASTF 496
           ++TF
Sbjct: 106 STTF 109


>At2g38070.1 68415.m04673 expressed protein  and genscan
          Length = 619

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCQTTSKKTTK 229
           K+P S I + V  +  +  KKV  F      QTT+KKT +
Sbjct: 197 KEPRSVIDEIVEEEEEEETKKVEDFTMEFNPQTTAKKTNR 236


>At2g07675.1 68415.m00903 ribosomal protein S12 mitochondrial family
           protein
          Length = 125

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCQTTSKKTTKY*WRDSVVKVTPSV 187
           K+PNSA RK  +V+L  N   + A +P +G  +    T     R   VK +P V
Sbjct: 43  KKPNSAPRKIAKVRL-SNRHDIFAHIPGEGHNSQEHSTVLI--RGGRVKDSPGV 93


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,339,542
Number of Sequences: 28952
Number of extensions: 290273
Number of successful extensions: 696
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 676
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 696
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1112061928
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).