SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60790.1 68418.m07627 ABC transporter family protein similar ...   101   3e-22
At3g54540.1 68416.m06035 ABC transporter family protein similar ...    66   1e-11
At1g64550.1 68414.m07317 ABC transporter family protein similar ...    53   1e-07
At5g09930.1 68418.m01148 ABC transporter family protein                44   8e-05
At5g64840.1 68418.m08157 ABC transporter family protein                43   1e-04
At3g13100.1 68416.m01640 ABC transporter family protein similar ...    37   0.011
At4g01830.1 68417.m00240 multidrug resistance P-glycoprotein, pu...    36   0.026
At1g02520.1 68414.m00203 multidrug resistance P-glycoprotein, pu...    36   0.026
At1g02530.1 68414.m00204 multidrug resistance P-glycoprotein, pu...    35   0.035
At4g01820.1 68417.m00239 multidrug resistance P-glycoprotein, pu...    34   0.081
At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transport...    34   0.081
At2g47000.1 68415.m05871 multidrug resistant (MDR) ABC transport...    34   0.081
At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PG...    34   0.081
At3g13090.1 68416.m01639 ABC transporter, putative similar to MR...    32   0.25 
At4g33460.1 68417.m04753 ABC transporter family protein ABC-type...    31   0.75 
At3g59140.1 68416.m06593 ABC transporter family protein putative...    31   0.75 
At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-g...    31   0.75 
At5g02270.1 68418.m00150 ABC transporter family protein NBD-like...    30   1.00 
At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, pu...    30   1.00 
At1g04120.1 68414.m00401 ABC transporter family protein Strong s...    30   1.00 
At1g04110.1 68414.m00400 subtilase family protein contains simil...    30   1.00 
At2g41700.1 68415.m05151 ABC transporter family protein similar ...    30   1.3  
At5g46540.1 68418.m05730 ABC transporter family protein contains...    29   1.7  
At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b...    29   1.7  
At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g...    29   1.7  
At1g07620.1 68414.m00817 GTP1/OBG family protein similar to SP|P...    29   1.7  
At5g10930.1 68418.m01268 CBL-interacting protein kinase 5 (CIPK5...    29   2.3  
At5g25110.1 68418.m02975 CBL-interacting protein kinase 25 (CIPK...    29   3.0  
At3g28360.1 68416.m03544 ABC transporter family protein similar ...    29   3.0  
At3g28345.1 68416.m03541 ABC transporter family protein similar ...    29   3.0  
At5g44110.1 68418.m05397 ABC transporter family protein                28   4.0  
At4g25450.1 68417.m03665 ABC transporter family protein similar ...    28   4.0  
At4g18050.1 68417.m02686 ABC transporter family protein contains...    28   4.0  
At1g03905.1 68414.m00375 ABC transporter family protein similar ...    28   4.0  
At1g48550.1 68414.m05429 vacuolar protein sorting-associated pro...    28   5.3  
At5g13610.1 68418.m01576 expressed protein                             27   7.0  
At2g34660.1 68415.m04258 glutathione S-conjugate ABC transporter...    27   7.0  
At1g53390.1 68414.m06052 ABC transporter family protein similar ...    27   7.0  
At1g30400.1 68414.m03716 glutathione S-conjugate ABC transporter...    27   7.0  
At4g25960.1 68417.m03735 multidrug resistance P-glycoprotein, pu...    27   9.3  
At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related conta...    27   9.3  
At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related conta...    27   9.3  
At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa...    27   9.3  
At2g07680.1 68415.m00992 ABC transporter family protein                27   9.3  

>At5g60790.1 68418.m07627 ABC transporter family protein similar to
           ABC transporter homolog PnATH GI:7573600 from [Populus
           nigra]
          Length = 595

 Score =  101 bits (243), Expect = 3e-22
 Identities = 43/68 (63%), Positives = 59/68 (86%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRDI+I + S+TF+G +L+ D++LELN GRRYGL+GLNGCGKS+LL A+ RRE+PIP+
Sbjct: 64  PQSRDIRIESLSVTFHGYDLIVDSMLELNYGRRYGLLGLNGCGKSTLLTAIGRREIPIPD 123

Query: 431 HIDIFHLT 454
            +DI+HL+
Sbjct: 124 QMDIYHLS 131


>At3g54540.1 68416.m06035 ABC transporter family protein similar to
           ABC50 GI:10863747 from [Rattus norvegicus]
          Length = 723

 Score = 66.5 bits (155), Expect = 1e-11
 Identities = 28/61 (45%), Positives = 46/61 (75%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +DI I +FS++  G ELL++  + ++ G+RYGL+G NG GKS+LL  L  R++P+P++ID
Sbjct: 161 KDITIESFSVSARGKELLKNASVRISHGKRYGLIGPNGMGKSTLLKLLAWRKIPVPKNID 220

Query: 440 I 442
           +
Sbjct: 221 V 221



 Score = 28.3 bits (60), Expect = 4.0
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 332 LNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++ G R  +VG NG GKS+LL  L    VP
Sbjct: 520 IDMGTRVAIVGPNGAGKSTLLNLLAGDLVP 549


>At1g64550.1 68414.m07317 ABC transporter family protein similar to
           ABC transporter protein GB:AAF31030 GI:6899653 from
           [Leishmania major]
          Length = 715

 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           TG     RDI + NF+++  G +L+ D  + L+ GR YGLVG NG GK++ L  +    +
Sbjct: 166 TGGGSAIRDIHMDNFNVSVGGRDLIVDGSITLSFGRHYGLVGRNGTGKTTFLRYMAMHAI 225

Query: 419 P-IPEHIDIFHL 451
             IP +  I H+
Sbjct: 226 EGIPTNCQILHV 237


>At5g09930.1 68418.m01148 ABC transporter family protein 
          Length = 678

 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 19/60 (31%), Positives = 35/60 (58%)
 Frame = +2

Query: 242 GCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           G +  S  +++ N S ++ G  +L+D   E+  G + GL+G+NG GK++ L  +  +E P
Sbjct: 76  GASSISSGVRLENISKSYEGITVLKDVTWEVKKGEKVGLIGVNGAGKTTQLRIITGQEEP 135



 Score = 33.9 bits (74), Expect = 0.081
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + + N    F    L     L +  G +  ++G NGCGKS+LL  +   E P+
Sbjct: 411 VTVKNLVFGFDDKMLFNKANLAIERGEKVAIIGPNGCGKSTLLKLIMGLEKPM 463


>At5g64840.1 68418.m08157 ABC transporter family protein
          Length = 692

 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 20/60 (33%), Positives = 34/60 (56%)
 Frame = +2

Query: 242 GCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           G +  S  +K+ N   ++ G  +L+D   E+  G + GLVG+NG GK++ L  +  +E P
Sbjct: 90  GASGISSGVKLENIRKSYKGVTVLKDVTWEVKRGEKVGLVGVNGAGKTTQLRIITGQEEP 149



 Score = 36.3 bits (80), Expect = 0.015
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + + N    F    L +   L +  G +  ++G NGCGKS+LL  +   E P+
Sbjct: 425 VNVKNIDFGFEDKMLFKKANLSIERGEKIAILGPNGCGKSTLLKLIMGLEKPV 477


>At3g13100.1 68416.m01640 ABC transporter family protein similar to
            ATP-binding cassette transporter MRP8 GI:18031899 from
            [Arabidopsis thaliana]; contains Pfam profile: PF00005
            ABC transporter
          Length = 1493

 Score = 36.7 bits (81), Expect = 0.011
 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 4/68 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSELLQDTLLELNC----GRRYGLVGLNGCGKSSLLAALRRREV 418
            PC  +I I N  +  YG  L    L  L C    G + G+VG  GCGKS+L+  L R   
Sbjct: 1236 PCRGEITICNLQVR-YGPHLPM-VLRGLTCTFRGGLKTGIVGRTGCGKSTLIQTLFRIVE 1293

Query: 419  PIPEHIDI 442
            P    I I
Sbjct: 1294 PAAGEIRI 1301


>At4g01830.1 68417.m00240 multidrug resistance P-glycoprotein,
            putative similar to multidrug resistant P-glycoprotein
            GI:4204793 from [Solanum tuberosum]
          Length = 1230

 Score = 35.5 bits (78), Expect = 0.026
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 3/63 (4%)
 Frame = +2

Query: 263  DIKIANFSITFYGS---ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
            DI++ + S T+      ++ +D  L +  G+   LVG +G GKS++++ L+R   P   H
Sbjct: 984  DIELCHISFTYQTRPDVQVFRDLCLSIRAGQTVALVGESGSGKSTVISLLQRFYDPDSGH 1043

Query: 434  IDI 442
            I +
Sbjct: 1044 ITL 1046


>At1g02520.1 68414.m00203 multidrug resistance P-glycoprotein,
            putative similar to multidrug-resistant protein CjMDR1
            GI:14715462 from [Coptis japonica]
          Length = 1278

 Score = 35.5 bits (78), Expect = 0.026
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 3/63 (4%)
 Frame = +2

Query: 263  DIKIANFSITFYGS---ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
            DI++ + S T+      ++ +D  L +  G+   LVG +G GKS++++ L+R   P   H
Sbjct: 1031 DIELRHLSFTYPARPDIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYDPDSGH 1090

Query: 434  IDI 442
            I +
Sbjct: 1091 ITL 1093


>At1g02530.1 68414.m00204 multidrug resistance P-glycoprotein,
            putative similar to multidrug-resistant protein CjMDR1
            GI:14715462 from [Coptis japonica]
          Length = 1273

 Score = 35.1 bits (77), Expect = 0.035
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +2

Query: 263  DIKIANFSITFY---GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            DI++ + S T+    G ++ +D  L +  G+   LVG +G GKS++++ L+R
Sbjct: 1026 DIELRHLSFTYPARPGIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLLQR 1077


>At4g01820.1 68417.m00239 multidrug resistance P-glycoprotein,
            putative similar to multidrug-resistant protein CjMDR1
            GI:14715462 from [Coptis japonica]
          Length = 1229

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +2

Query: 263  DIKIANFSITFYGS---ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
            DI++ + S T+      ++ +D    +  G+   LVG +G GKS++++ L+R   P   H
Sbjct: 983  DIELCHISFTYQTRPDVQIFRDLCFAIRAGQTVALVGESGSGKSTVISLLQRFYDPDSGH 1042

Query: 434  IDI 442
            I +
Sbjct: 1043 ITL 1045


>At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transporter,
            putative similar to multidrug-resistant protein CjMDR1
            GI:14715462 from [Coptis japonica]; contains Pfam
            profiles PF00005: ABC transporter, PF00664: ABC
            transporter transmembrane region
          Length = 1292

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++ QD  L +  G+   LVG +G GKS+++A L+R
Sbjct: 1064 QIFQDLCLSIRAGKTIALVGESGSGKSTVIALLQR 1098


>At2g47000.1 68415.m05871 multidrug resistant (MDR) ABC transporter,
            putative similar to multidrug-resistant protein CjMDR1
            [Coptis japonica] GI:14715462, MDR-like p-glycoprotein
            [Arabidopsis thaliana] GI:24324262; contains Pfam
            profiles PF00005: ABC transporter, PF00664: ABC
            transporter transmembrane region
          Length = 1286

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++ QD  L +  G+   LVG +G GKS+++A L+R
Sbjct: 1058 QIFQDLCLSIRAGKTVALVGESGSGKSTVIALLQR 1092


>At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PGP1)
            identical to P-glycoprotein GI:3849833 from [Arabidopsis
            thaliana]; homologous to mammalian mdr gene,contains
            ATP-binding cassette; related to multi drug resistance
            proteins
          Length = 1286

 Score = 33.9 bits (74), Expect = 0.081
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++ +D  L    G+   LVG +GCGKSS+++ ++R
Sbjct: 1040 QIFRDLSLRARAGKTLALVGPSGCGKSSVISLIQR 1074



 Score = 27.1 bits (57), Expect = 9.3
 Identities = 11/35 (31%), Positives = 22/35 (62%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L +  L +  G+   LVG +G GKS++++ + R
Sbjct: 384 KILNNFCLSVPAGKTIALVGSSGSGKSTVVSLIER 418


>At3g13090.1 68416.m01639 ABC transporter, putative similar to
            MRP-like ABC transporter [Arabidopsis thaliana]
            GI:2316016; contains Pfam profile: PF00005 ABC
            transporter
          Length = 1466

 Score = 32.3 bits (70), Expect = 0.25
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 4/68 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSELLQDTLLELNC----GRRYGLVGLNGCGKSSLLAALRRREV 418
            P   +I I N  +  YG  L    L  L C    G + G+VG  GCGKS+L+  L R   
Sbjct: 1214 PSRGEITICNLQVR-YGPHLPM-VLHGLTCTFPGGLKTGIVGRTGCGKSTLIQTLFRIVE 1271

Query: 419  PIPEHIDI 442
            P    I I
Sbjct: 1272 PAAGEIRI 1279


>At4g33460.1 68417.m04753 ABC transporter family protein ABC-type
           transport protein sll1623 -Synechocystis,PIR2:S74812
          Length = 271

 Score = 30.7 bits (66), Expect = 0.75
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +L+D    +  G+ + ++G NGCGKS+LL  L
Sbjct: 59  ILRDCSFRIPSGQLWMILGPNGCGKSTLLKIL 90


>At3g59140.1 68416.m06593 ABC transporter family protein putative
           multi resistance protein mrp - Arabidopsis thaliana,
           EMBL:ATMRPPROT
          Length = 1453

 Score = 30.7 bits (66), Expect = 0.75
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           IK A+FS    GS    L++  LE+  G +  + G  G GKS+LLAA+      +   ID
Sbjct: 603 IKSASFSWEEKGSTKPNLRNVSLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTID 662

Query: 440 IF 445
            +
Sbjct: 663 FY 664



 Score = 29.1 bits (62), Expect = 2.3
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +2

Query: 341  GRRYGLVGLNGCGKSSLLAALRRREVPI 424
            G + G+VG  G GK++L++AL R   P+
Sbjct: 1234 GHKIGIVGRTGSGKTTLISALFRLVEPV 1261


>At3g28380.1 68416.m03546 P-glycoprotein, putative similar to
           P-glycoprotein homologue GI:2292907 from [Hordeum
           vulgare subsp. vulgare]
          Length = 1240

 Score = 30.7 bits (66), Expect = 0.75
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           +  D  L++  G+   LVG +G GKS++++ L+R   PI   I
Sbjct: 376 IFDDLCLKIPAGKTVALVGGSGSGKSTVISLLQRFYDPIAGEI 418



 Score = 27.1 bits (57), Expect = 9.3
 Identities = 11/45 (24%), Positives = 26/45 (57%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
            + ++  +E++ G+   +VG +G GKS+++  + R   P+   + I
Sbjct: 1012 IFENFSIEIDEGKSTAIVGTSGSGKSTIIGLIERFYDPLKGTVKI 1056


>At5g02270.1 68418.m00150 ABC transporter family protein NBD-like
           protein POP, Arabidopsis thaliana, EMBL:AF127664
          Length = 328

 Score = 30.3 bits (65), Expect = 1.00
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           L++D  + LN   R  LVG NG GK+++L  L  + +  P  + +
Sbjct: 37  LIEDFSITLNSSDRCLLVGSNGAGKTTILKILGGKHMVEPHMVRV 81


>At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein,
            putative similar to mdr-like P-glycoprotein GI:3849833
            from [Arabidopsis thaliana]; contains Pfam profiles
            PF00005: ABC transporter and PF00664: ABC transporter
            transmembrane region; identical to cDNA MDR-like
            p-glycoprotein (At3g28860) GI:24324261
          Length = 1252

 Score = 30.3 bits (65), Expect = 1.00
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            + +D  L +  G    LVG +G GKSS++A + R   P+
Sbjct: 1027 VFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPL 1065


>At1g04120.1 68414.m00401 ABC transporter family protein Strong
            similarity to MRP-like ABC transporter gb|U92650 from A.
            thaliana and canalicular multi-drug resistance protein
            gb|L49379 from Rattus norvegicus
          Length = 1514

 Score = 30.3 bits (65), Expect = 1.00
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSELLQDTLLELNC----GRRYGLVGLNGCGKSSLLAALRRREV 418
            P +  I++ +  + +  +E L   L  ++C    G++ G+VG  G GKS+L+ AL R   
Sbjct: 1263 PATGTIELVDVKVRY--AENLPTVLHGVSCVFPGGKKIGIVGRTGSGKSTLIQALFRLIE 1320

Query: 419  PIPEHIDI 442
            P    I I
Sbjct: 1321 PTAGKITI 1328


>At1g04110.1 68414.m00400 subtilase family protein contains
           similarity to subtilisin-like protease GI:3687307 from
           [Lycopersicon esculentum]
          Length = 775

 Score = 30.3 bits (65), Expect = 1.00
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +2

Query: 350 YGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPI 478
           Y +   NGC  S +LAA+   +V I + +D+  L+ GG   P+
Sbjct: 260 YKVCWFNGCYSSDILAAI---DVAIQDKVDVLSLSLGGFPIPL 299


>At2g41700.1 68415.m05151 ABC transporter family protein similar to
            ATP-binding cassette transporter ABCA1 GI:18031705 from
            [Arabidopsis thaliana]
          Length = 1822

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +2

Query: 311  LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            +Q     +  G  +G +G NG GK++ L+ L   E P
Sbjct: 1414 VQSLTFSVQAGECFGFLGTNGAGKTTTLSMLSGEETP 1450


>At5g46540.1 68418.m05730 ABC transporter family protein contains Pfam
            profile: PF00005 ABC transporter; similar to
            multidrug-resistant protein CjMDR1 GI:14715462 from
            [Coptis japonica]
          Length = 1248

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++  D  L ++ G+   LVG +G GKS++++ L R
Sbjct: 1021 QIFSDLCLTISSGQTVALVGESGSGKSTVISLLER 1055


>At3g28415.1 68416.m03551 P-glycoprotein, putative contains
           ATP-binding cassette; related to multi drug resistance
           proteins
          Length = 1221

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           +  D  L +  G+   LVG +G GKS++++ L+R   PI
Sbjct: 355 IFDDLCLRIPSGKSVALVGGSGSGKSTVISLLQRFYDPI 393


>At3g28390.1 68416.m03547 P-glycoprotein, putative similar to
           P-glycoprotein homologue GI:2292907 from [Hordeum
           vulgare subsp. vulgare]
          Length = 1225

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           +  D  L +  G+   LVG +G GKS++++ L+R   PI   I
Sbjct: 364 IFDDLCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPIAGEI 406


>At1g07620.1 68414.m00817 GTP1/OBG family protein similar to
           SP|P20964 Spo0B-associated GTP-binding protein {Bacillus
           subtilis}; contains Pfam profile PF01018: GTP1/OBG
           family
          Length = 1016

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           GSE +   +LEL      GLVG+   GKS+LL AL R
Sbjct: 814 GSEAV--LILELKSIADVGLVGMPNAGKSTLLGALSR 848


>At5g10930.1 68418.m01268 CBL-interacting protein kinase 5 (CIPK5)
           identical to CBL-interacting protein kinase 5
           GP|9280632|gb|AAF86504 [Arabidopsis thaliana]
          Length = 445

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCG 343
           D+KI++F ++    ++LQD LL   CG
Sbjct: 148 DLKISDFGLSALPEQILQDGLLHTQCG 174


>At5g25110.1 68418.m02975 CBL-interacting protein kinase 25 (CIPK25)
           identical to CBL-interacting protein kinase 25
           [Arabidopsis thaliana] gi|17646697|gb|AAL41008
          Length = 488

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCG 343
           D+K+++F ++    ++LQD LL   CG
Sbjct: 178 DLKVSDFGLSALPEQILQDGLLHTQCG 204


>At3g28360.1 68416.m03544 ABC transporter family protein similar to
           P-glycoprotein homologue GI:2292907 from [Hordeum
           vulgare subsp. vulgare]
          Length = 1158

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +  D  L++  G+   LVG +G GKS++++ L+R
Sbjct: 293 IFDDLCLKIPSGKTVALVGGSGSGKSTVISLLQR 326


>At3g28345.1 68416.m03541 ABC transporter family protein similar to
           P-glycoprotein [Arabidopsis thaliana] GI:3849833;
           contains Pfam profiles PF00005: ABC transporter,
           PF00664: ABC transporter transmembrane region
          Length = 1240

 Score = 28.7 bits (61), Expect = 3.0
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +2

Query: 302 SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           + +  D  L +  G+   LVG +G GKS++++ L+R   P+   I
Sbjct: 374 TSIFDDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPLAGEI 418


>At5g44110.1 68418.m05397 ABC transporter family protein
          Length = 282

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 15/29 (51%), Positives = 18/29 (62%)
 Frame = +2

Query: 317 DTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           D  L+L  G R  LVG NG GK++LL  L
Sbjct: 31  DFNLDLPAGSRCLLVGANGSGKTTLLKIL 59


>At4g25450.1 68417.m03665 ABC transporter family protein similar to
           multidrug resistance protein 2 SP:P21440 from [Mus
           musculus]
          Length = 714

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           ++L    L LN G    LVG +G GKS+++  L R   P    I +
Sbjct: 486 KVLDGLSLTLNSGTVTALVGSSGAGKSTIVQLLARFYEPTQGRITV 531


>At4g18050.1 68417.m02686 ABC transporter family protein contains Pfam
            profile: PF00005 ABC transporter; similar to
            multidrug-resistant protein CjMDR1 GI:14715462 from
            [Coptis japonica]
          Length = 1281

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 11/35 (31%), Positives = 22/35 (62%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++ +D  L +  G+   LVG +G GKS++++ + R
Sbjct: 1009 QIFRDLCLTIPSGKTVALVGESGSGKSTVISMIER 1043


>At1g03905.1 68414.m00375 ABC transporter family protein similar to
           NBD-like protein GB:AAD20643
          Length = 290

 Score = 28.3 bits (60), Expect = 4.0
 Identities = 15/29 (51%), Positives = 18/29 (62%)
 Frame = +2

Query: 317 DTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           D  L+L  G R  LVG NG GK++LL  L
Sbjct: 32  DFNLDLPAGSRCLLVGANGSGKTTLLKIL 60


>At1g48550.1 68414.m05429 vacuolar protein sorting-associated
           protein 26 family protein / VPS26 family protein
           contains Pfam profile PF03643: Vacuolar protein
           sorting-associated protein 26
          Length = 327

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +2

Query: 272 IANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAA-LRRREVPIPEHIDIFH 448
           +  F  TF+G+ +    LL  +  R Y    L+   +  + +  +   E PIP  I IF+
Sbjct: 107 VEKFYETFHGTNINIQYLLTADIPRGYLHKPLSATMEFIIESGRVDLPERPIPPEIVIFY 166

Query: 449 LTRGGARYPIRP 484
           +T+   R+P+ P
Sbjct: 167 ITQDTQRHPLLP 178


>At5g13610.1 68418.m01576 expressed protein
          Length = 402

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -1

Query: 123 YHFRLRSSHEPPASCFCR*LAPSSS 49
           +HF LRSS   P  CF   +A S+S
Sbjct: 38  FHFSLRSSSNIPTRCFSNVVAKSNS 62


>At2g34660.1 68415.m04258 glutathione S-conjugate ABC transporter
            (MRP2) almost identical to MgATP-energized glutathione
            S-conjugate pump GI:2909781 from [Arabidopsis thaliana]
          Length = 1623

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 347  RYGLVGLNGCGKSSLLAALRR 409
            + G+VG  G GKSSLL AL R
Sbjct: 1271 KVGIVGRTGAGKSSLLNALFR 1291


>At1g53390.1 68414.m06052 ABC transporter family protein similar to
           ATP-binding cassette, sub-family G, member 2
           (Placenta-specific ATP- binding cassette transporter)
           (Breast cancer resistance protein) SP:Q9UNQ0 from [Homo
           sapiens]
          Length = 1092

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           G ++L+     +  GR   ++G +G GK+SLL+AL  + V
Sbjct: 503 GKQVLRCVTGSMKPGRITAVMGPSGAGKTSLLSALAGKAV 542


>At1g30400.1 68414.m03716 glutathione S-conjugate ABC transporter
            (MRP1) identical to glutathione S-conjugate transporting
            ATPase (AtMRP1) [Arabidopsis thaliana] GI:2340166
          Length = 1622

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 347  RYGLVGLNGCGKSSLLAALRR 409
            + G+VG  G GKSSLL AL R
Sbjct: 1266 KVGIVGRTGAGKSSLLNALFR 1286


>At4g25960.1 68417.m03735 multidrug resistance P-glycoprotein,
           putative similar to multidrug resistant P-glycoprotein
           GI:4204793 from [Solanum tuberosum]
          Length = 1233

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           K A FS       ++ D L L +  G+   LVG +G GKS++++ + R   PI
Sbjct: 364 KDATFSYPSRPDVVIFDRLNLAIPAGKIVALVGGSGSGKSTVISLIERFYEPI 416


>At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related contains
           weak similarity to 2-phosphoglycerate kinase (GI:467751)
           [Methanothermus fervidus]
          Length = 698

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 2/61 (3%)
 Frame = +2

Query: 356 LVGLNGCGKSSLLAALRRR--EVPIPEHIDIFHLTRGGARYPIRPIVSRITIHGRRFTNV 529
           L G +GCGKS+L A L  R     +     I H+ R  A     P++   T H   + + 
Sbjct: 144 LCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWASTYHAGEYLDP 203

Query: 530 V 532
           V
Sbjct: 204 V 204


>At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related contains
           weak similarity to 2-phosphoglycerate kinase (GI:467751)
           [Methanothermus fervidus]
          Length = 717

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 2/61 (3%)
 Frame = +2

Query: 356 LVGLNGCGKSSLLAALRRR--EVPIPEHIDIFHLTRGGARYPIRPIVSRITIHGRRFTNV 529
           L G +GCGKS+L A L  R     +     I H+ R  A     P++   T H   + + 
Sbjct: 163 LCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWASTYHAGEYLDP 222

Query: 530 V 532
           V
Sbjct: 223 V 223


>At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam
           domain, PF01926: GTPase of unknown function
          Length = 582

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +2

Query: 329 ELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           EL      G++GL   GKSSL+ +L+R  V
Sbjct: 249 ELKKSITVGIIGLPNVGKSSLINSLKRAHV 278


>At2g07680.1 68415.m00992 ABC transporter family protein 
          Length = 1194

 Score = 27.1 bits (57), Expect = 9.3
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +2

Query: 341  GRRYGLVGLNGCGKSSLLAALRR 409
            G   G++G  G GKSS+L AL R
Sbjct: 985  GMHVGVIGRTGAGKSSILNALFR 1007


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,340,961
Number of Sequences: 28952
Number of extensions: 244494
Number of successful extensions: 667
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 619
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 667
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1161268208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).