SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g47210.1 68415.m05896 myb family transcription factor contain...    29   2.8  
At3g02290.2 68416.m00211 zinc finger (C3HC4-type RING finger) fa...    28   5.0  
At3g02290.1 68416.m00210 zinc finger (C3HC4-type RING finger) fa...    28   5.0  

>At2g47210.1 68415.m05896 myb family transcription factor contains
           Pfam profile: PF00249 myb DNA-binding domain
          Length = 441

 Score = 28.7 bits (61), Expect = 2.8
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 492 KVVNRTLTSIESAGVNFTVRVPDRDVCSLHLFKYRPRLGLRTL*HNLQ 349
           + + R   +++  GVN   +VP + VC  HL   +  L L  L   LQ
Sbjct: 324 RTIKRVEQTLQDLGVNLKPKVPTKTVCDEHLELRKEILTLLNLQKQLQ 371


>At3g02290.2 68416.m00211 zinc finger (C3HC4-type RING finger)
           family protein contains zinc finger motif, C3HC4 type
           (RING finger)
          Length = 231

 Score = 27.9 bits (59), Expect = 5.0
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -3

Query: 478 DVDQYRKCRCELYRSSPGSRCLLASFVQI 392
           D+D+Y      +YR+ P  RCL  +F+ +
Sbjct: 12  DIDEYMNPNSSVYRNCPCIRCLAHNFLNL 40


>At3g02290.1 68416.m00210 zinc finger (C3HC4-type RING finger)
           family protein contains zinc finger motif, C3HC4 type
           (RING finger)
          Length = 231

 Score = 27.9 bits (59), Expect = 5.0
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -3

Query: 478 DVDQYRKCRCELYRSSPGSRCLLASFVQI 392
           D+D+Y      +YR+ P  RCL  +F+ +
Sbjct: 12  DIDEYMNPNSSVYRNCPCIRCLAHNFLNL 40


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,584,448
Number of Sequences: 28952
Number of extensions: 230703
Number of successful extensions: 478
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 470
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 478
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1082538160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).