SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   132   2e-31
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   132   2e-31
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   132   2e-31
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   131   3e-31
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   131   3e-31
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   131   3e-31
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   128   4e-30
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   128   4e-30
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   128   4e-30
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   123   1e-28
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...    87   8e-18
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...    83   1e-16
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    57   8e-09
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    57   1e-08
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...    56   2e-08
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    47   8e-06
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...    40   0.001
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.083
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    33   0.19 
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    31   0.58 
At2g05290.1 68415.m00557 expressed protein similar to zinc finge...    30   1.0  
At1g16690.2 68414.m01999 transcription factor-related similar to...    30   1.3  
At1g16690.1 68414.m01998 transcription factor-related similar to...    30   1.3  
At4g05360.1 68417.m00818 zinc knuckle (CCHC-type) family protein...    29   1.8  
At3g61300.1 68416.m06860 C2 domain-containing protein anthranila...    29   1.8  
At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase, put...    28   4.1  
At5g57320.1 68418.m07160 villin, putative similar to villin 2 (V...    28   5.4  
At5g02330.1 68418.m00156 DC1 domain-containing protein contains ...    28   5.4  
At5g06610.1 68418.m00747 expressed protein contains Pfam profile...    27   7.2  
At2g47500.1 68415.m05929 kinesin motor protein-related                 27   7.2  
At5g53240.1 68418.m06618 expressed protein contains Pfam profile...    27   9.5  
At5g52930.1 68418.m06568 expressed protein contains Pfam profile...    27   9.5  
At4g00700.1 68417.m00096 C2 domain-containing protein contains I...    27   9.5  
At3g24460.1 68416.m03069 TMS membrane family protein / tumour di...    27   9.5  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  132 bits (319), Expect = 2e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNTPAM 134



 Score =  102 bits (245), Expect = 2e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  132 bits (318), Expect = 2e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNTPAM 134



 Score =  102 bits (244), Expect = 2e-22
 Identities = 58/106 (54%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  132 bits (318), Expect = 2e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNTPAM 134



 Score =  102 bits (244), Expect = 2e-22
 Identities = 58/106 (54%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  131 bits (317), Expect = 3e-31
 Identities = 71/131 (54%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNVPAM 134



 Score =  100 bits (240), Expect = 6e-22
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  131 bits (317), Expect = 3e-31
 Identities = 70/131 (53%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHP+LLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNAPAM 134



 Score =  100 bits (239), Expect = 8e-22
 Identities = 57/106 (53%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  131 bits (317), Expect = 3e-31
 Identities = 70/131 (53%), Positives = 80/131 (61%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVG   ++K 
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHP+LLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNAPAM 134



 Score =  100 bits (239), Expect = 8e-22
 Identities = 57/106 (53%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNAPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  128 bits (308), Expect = 4e-30
 Identities = 67/131 (51%), Positives = 79/131 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVG   ++K 
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNSPAM 134



 Score =  100 bits (239), Expect = 8e-22
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHG+V+NWDDMEKIWHHTFYNEL +AP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  128 bits (308), Expect = 4e-30
 Identities = 67/131 (51%), Positives = 79/131 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVG   ++K 
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNSPAM 134



 Score =  100 bits (239), Expect = 8e-22
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHG+V+NWDDMEKIWHHTFYNEL +AP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  128 bits (308), Expect = 4e-30
 Identities = 67/131 (51%), Positives = 79/131 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVG   ++K 
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPKA   KMT I
Sbjct: 65  GILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFNSPAM 134



 Score =  100 bits (239), Expect = 8e-22
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHG+V+NWDDMEKIWHHTFYNEL +AP   P         P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF +P    V IQ VL  +   R      DS  G+S
Sbjct: 119 EKMTQI-MFETFNSPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 162


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  123 bits (296), Expect = 1e-28
 Identities = 64/131 (48%), Positives = 79/131 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VG   +A+ 
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQARR 65

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHP+LLTEAPLNPK    KMT I
Sbjct: 66  GILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNREKMTQI 125

Query: 455 MFPKHFTRPAI 487
           MF + F  P++
Sbjct: 126 MF-ESFAFPSM 135



 Score = 91.9 bits (218), Expect = 3e-19
 Identities = 50/106 (47%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQ++RG L+LKYPIEHG+V+NWDDMEKIWHHTFYNEL + P   P         P+ +R
Sbjct: 60  EAQARRGILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNR 119

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + ++F  P    +GIQ VL  ++  R      DS  G+S
Sbjct: 120 EKMTQI-MFESFAFP-SMYIGIQAVLSLYSSGRTTGIVLDSGDGVS 163


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score = 87.0 bits (206), Expect = 8e-18
 Identities = 53/129 (41%), Positives = 63/129 (48%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG    A       
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHANRDILTL 58

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
                           +             PEEHPVLLTEAP NPKA   KMT IMF + 
Sbjct: 59  KDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHPVLLTEAPYNPKANREKMTQIMF-ES 117

Query: 470 FTRPAIVPS 496
           F  PA+  S
Sbjct: 118 FDVPAMYVS 126



 Score = 78.2 bits (184), Expect = 4e-15
 Identities = 46/107 (42%), Positives = 59/107 (55%)
 Frame = +1

Query: 214 RDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           RDG    E  +   E  + R  LTLK P+EHGIV NWDDMEKIWH+TFYNEL V P   P
Sbjct: 35  RDGLNPNESYV-GEEGHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHP 93

Query: 394 SPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
                    P+ +REK     + ++F  P    V +Q+VL  ++  R
Sbjct: 94  VLLTEAPYNPKANREKMTQI-MFESFDVPA-MYVSMQSVLYLYSSGR 138


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score = 83.0 bits (196), Expect = 1e-16
 Identities = 46/111 (41%), Positives = 61/111 (54%)
 Frame = +1

Query: 241 LLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQ 420
           L    +A+++ G LTL YP+EHG+V+NWDDMEKIW+HTFY+EL VAP   P         
Sbjct: 9   LFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLN 68

Query: 421 PQGHREKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           P+  REK     + +TF  P    +G+Q  L      R      DS  G+S
Sbjct: 69  PKADREKMTQI-MFETFAVP-SMYIGMQAALSLHASGRTTGTVLDSGDGVS 117


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 57.2 bits (132), Expect = 8e-09
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVG 38



 Score = 38.7 bits (86), Expect = 0.003
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = +1

Query: 217 DGRYGTEGLLCRSEAQS-KRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           D   G   L   S+A + +R  + +  P + GIVT+WD ++ +W H F N L + P   P
Sbjct: 61  DKEKGKRKLYTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHP 120



 Score = 27.9 bits (59), Expect = 5.4
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERK 442
           P EHP+LL E PLN +    K
Sbjct: 116 PTEHPMLLAEPPLNSQQQREK 136


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38



 Score = 37.9 bits (84), Expect = 0.005
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 253 SEAQS-KRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           S+A S +R  + +  PI+ GIV++WD ++ IW H F + L + P   P
Sbjct: 79  SQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHP 126



 Score = 35.1 bits (77), Expect = 0.036
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
           P EHP+LL E PLN +    K   +MF K+
Sbjct: 122 PTEHPMLLAEPPLNTQQQREKAAELMFEKY 151


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 39/127 (30%), Positives = 59/127 (46%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG     +RH+ 
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGETCSELRHQL 66

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                           +  + W         ++    P +  +LLT+ PLNP     KM 
Sbjct: 67  DINYPVHNGIVQNWDDMEHV-WDHAFYNELKIN----PSDCKILLTDPPLNPSKNREKMI 121

Query: 449 HIMFPKH 469
             MF K+
Sbjct: 122 ETMFEKY 128



 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 20/34 (58%), Positives = 25/34 (73%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L + YP+ +GIV NWDDME +W H FYNEL + P
Sbjct: 66  LDINYPVHNGIVQNWDDMEHVWDHAFYNELKINP 99


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 47.2 bits (107), Expect = 8e-06
 Identities = 39/149 (26%), Positives = 68/149 (45%), Gaps = 10/149 (6%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VG    +       
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGDLDPSMMKYFDC 77

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWV-------SPPEEHPVLLTEAPLNPKATERKMT 448
                     + + + +F I+   + +            +HP+L+TE   NP  +  KM 
Sbjct: 78  TRSGPRSPFDSNVVY-QFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMA 136

Query: 449 HIMFPKHFTRPAI---VPSAFKPCFLLLH 526
            ++F + +  PA+   V +AF   +  LH
Sbjct: 137 ELLF-ETYGVPAVAFGVDAAFSYKYNQLH 164


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 286 LKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L YPIEHG V +WD ME+ W    +N L   P
Sbjct: 86  LHYPIEHGQVEDWDAMERYWQQCIFNYLRCDP 117



 Score = 35.9 bits (79), Expect = 0.020
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36



 Score = 28.7 bits (61), Expect = 3.1
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMF 460
           PE+H  LLTE+PL P  +      I+F
Sbjct: 117 PEDHYFLLTESPLTPPESREYTGEILF 143


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.083
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -1

Query: 231 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 94
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 32.7 bits (71), Expect = 0.19
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35



 Score = 29.9 bits (64), Expect = 1.3
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 286 LKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           ++ PI+ G + N D   +IW H F + L +AP
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAP 92


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 31.1 bits (67), Expect = 0.58
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTFYNELG 372
           PIE G++ +WD ME +  +  Y  LG
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLG 82



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGR 199
           ALVVD GS   KAG A  D +P  + PS + R
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR 34


>At2g05290.1 68415.m00557 expressed protein similar to zinc finger
           protein [Arabidopsis thaliana] GI:976277
          Length = 383

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 311 IPCSMGYLRVRKPLLLCASLLHKSPSVPYRPS 216
           +   + Y R+RK    C  L H+ P  PY PS
Sbjct: 193 VKIGIDYERIRKRCFQCQRLTHEKPRCPYLPS 224


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 1/54 (1%)
 Frame = +1

Query: 277 FLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPR-GTPSPAH*GSPQPQGHR 435
           +L++KY + H I + W +  +IW       L   P     +P +   P+ + HR
Sbjct: 177 YLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPPPVNDTNPYNVFRPREKAHR 230


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 1/54 (1%)
 Frame = +1

Query: 277 FLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPR-GTPSPAH*GSPQPQGHR 435
           +L++KY + H I + W +  +IW       L   P     +P +   P+ + HR
Sbjct: 177 YLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPPPVNDTNPYNVFRPREKAHR 230


>At4g05360.1 68417.m00818 zinc knuckle (CCHC-type) family protein
           contains Pfam domain, PF00098: Zinc knuckle
          Length = 735

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = -3

Query: 517 QEARFECRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQDWVFLGG 377
           +E +   R  N G  K+     +G    CGLG +G+ S+ D VF+ G
Sbjct: 527 EETQKNLRMLNNGTKKLGHILSIGKTDKCGLGFKGNPSKSDPVFVYG 573


>At3g61300.1 68416.m06860 C2 domain-containing protein anthranilate
           phosphoribosyltransferase (fragment) - Pisum sativum,
           PIR:T06460
          Length = 972

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 22/81 (27%), Positives = 31/81 (38%)
 Frame = +1

Query: 343 WHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLLAF 522
           +H+   NE   +PRG         P PQ       P   S  +  PR     I T  + F
Sbjct: 158 FHNIPTNESNHSPRGNQQSFQPQPPPPQSQTALPPPMMESSLYQAPRF-GTPIPTT-MGF 215

Query: 523 TPFRGRYPTRDSRLGLSGGNR 585
            P    Y  ++++  L GG R
Sbjct: 216 NPNPPDYSIKETKPILGGGKR 236


>At3g19480.1 68416.m02469 D-3-phosphoglycerate dehydrogenase,
           putative / 3-PGDH, putative similar to SP:O04130 from
           [Arabidopsis thaliana]
          Length = 588

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = -2

Query: 341 IFSMSSQLVTIPCSMGYLRVRKPLLLCAS 255
           IFS SS+LVT P S+  +R R+ ++L  S
Sbjct: 10  IFSSSSRLVTTPSSVFPIRQRRRIILVTS 38


>At5g57320.1 68418.m07160 villin, putative similar to villin 2
           (VLN2) [Arabidopsis thaliana] GI:3415115, villin 3
           (VLN3) [Arabidopsis thaliana] GI:3415117; contains Pfam
           profiles PF00626: Gelsolin repeat, PF02209: Villin
           headpiece domain
          Length = 962

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
 Frame = -3

Query: 418 EGSLSEQDWVFLGGR--HPAHCRRYDAKSSP 332
           EGS SEQ W  LGG+  +P+   + D +S P
Sbjct: 594 EGSESEQFWELLGGKSEYPSQKIKRDGESDP 624


>At5g02330.1 68418.m00156 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 656

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 13/75 (17%)
 Frame = -2

Query: 338 FSMSSQL-VTIPCSMG--------YLRVRKPLLLCASLLHKSPSVPYRPSR--PDGGA-- 198
           +++SSQ   T P S G        +L +++PL LC SL  K+  + Y  S   P   +  
Sbjct: 22  YTLSSQTDTTTPSSSGETAIDGDDHLSLQQPLFLCPSLRLKADEINYSYSEILPFNISPY 81

Query: 197 FPRSRGTRREEHHLL 153
           FP  RG  ++  HLL
Sbjct: 82  FPSIRGADQQVQHLL 96


>At5g06610.1 68418.m00747 expressed protein contains Pfam profile
           PF04788: Protein of unknown function (DUF620)
          Length = 368

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -1

Query: 207 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 85
           WR  P +  + A+GA  P + AL   +PL+ ++  +S+  +
Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207


>At2g47500.1 68415.m05929 kinesin motor protein-related 
          Length = 974

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = -2

Query: 260 ASLLHKSPSVPYRPSR 213
           ASL HK+P VPYR S+
Sbjct: 656 ASLAHKNPHVPYRNSK 671


>At5g53240.1 68418.m06618 expressed protein contains Pfam profile
           PF03478: Protein of unknown function (DUF295)
          Length = 361

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/46 (32%), Positives = 21/46 (45%)
 Frame = +2

Query: 344 GIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRP 481
           G I S+  WV   ++  +L  +  LNP A+E     I  P   T P
Sbjct: 75  GTIGSSHGWVVTLKDDGILRLQDDLNPVASETDPKRISLPPLVTLP 120


>At5g52930.1 68418.m06568 expressed protein contains Pfam profile
           PF03478: Protein of unknown function (DUF295);
           expression supported by MPSS
          Length = 359

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +2

Query: 347 IIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRP 481
           +I ++  W++  +E  ++  +  LNP A++    HI  P   T P
Sbjct: 80  MIGASHGWIATLKEDGIMRLQDDLNPVASDSDPKHIPLPPLVTLP 124


>At4g00700.1 68417.m00096 C2 domain-containing protein contains
           INTERPRO:IPR000008 C2 domain
          Length = 1006

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%)
 Frame = +1

Query: 235 EGLLCRSEAQSKRGFLTLKYPIE-HGIVTNWDDMEKIWHHTFY 360
           +GLL R +  S   F+ LK+  +     T  +D   +WH  FY
Sbjct: 14  QGLLQRDKHNSCSPFVELKFDNQIFRATTKHNDPNPVWHECFY 56


>At3g24460.1 68416.m03069 TMS membrane family protein / tumour
           differentially expressed (TDE) family protein contains
           Pfam domain, PF03348: TMS membrane protein/tumour
           differentially expressed protein (TDE)
          Length = 409

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = -1

Query: 543 VTAPKRCKSKKHGLNADGTMAGRVKCFGNMIWVIFLSVALGLRGASVSRTGCSSG 379
           VT  K CK  ++ L  DG +   + CF    +V+FLS  LG      SR    SG
Sbjct: 69  VTRFKNCKGGENCLGTDGVLRVSLGCF-LFYFVMFLS-TLGTSKTHSSRDRWHSG 121


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,924,566
Number of Sequences: 28952
Number of extensions: 407502
Number of successful extensions: 1168
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1106
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1154
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1187288784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).