SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g33020.1 68415.m04047 leucine-rich repeat family protein cont...    29   3.2  
At4g08850.2 68417.m01455 leucine-rich repeat family protein / pr...    28   5.5  
At4g08850.1 68417.m01454 leucine-rich repeat family protein / pr...    28   5.5  
At1g73080.1 68414.m08450 leucine-rich repeat transmembrane prote...    27   7.3  
At1g70970.1 68414.m08187 F-box family protein contains F-box dom...    27   7.3  
At5g04730.1 68418.m00484 expressed protein ; expression supporte...    27   9.6  
At4g09400.1 68417.m01549 hypothetical protein similar to At3g453...    27   9.6  

>At2g33020.1 68415.m04047 leucine-rich repeat family protein
           contains leucine rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611
          Length = 864

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 11/22 (50%), Positives = 17/22 (77%)
 Frame = -1

Query: 67  LGALSLLMLVNLAHRKLKTSLP 2
           LG+LS L+ +++AH KLK  +P
Sbjct: 757 LGSLSFLVYISVAHNKLKGEIP 778


>At4g08850.2 68417.m01455 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 1009

 Score = 27.9 bits (59), Expect = 5.5
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 163 LPVGIERWRNK--LFVSVPRWRSGIPATLNYIPWTLHMNHPRN 285
           +P GI    N   L +S  R+ S IP TLN +P   +MN  RN
Sbjct: 542 IPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRN 584


>At4g08850.1 68417.m01454 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 1045

 Score = 27.9 bits (59), Expect = 5.5
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 163 LPVGIERWRNK--LFVSVPRWRSGIPATLNYIPWTLHMNHPRN 285
           +P GI    N   L +S  R+ S IP TLN +P   +MN  RN
Sbjct: 542 IPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRN 584


>At1g73080.1 68414.m08450 leucine-rich repeat transmembrane protein
           kinase, putative similar to receptor protein kinase
           GI:1389566 from [Arabidopsis thaliana]
          Length = 1123

 Score = 27.5 bits (58), Expect = 7.3
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -2

Query: 327 ICLIRCLRSSGRALISGMVHMERPGNVVQSSW 232
           I  + CL S G  L+S + H++R    V S+W
Sbjct: 23  IISVSCLNSDGLTLLSLLKHLDRVPPQVTSTW 54


>At1g70970.1 68414.m08187 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 402

 Score = 27.5 bits (58), Expect = 7.3
 Identities = 8/21 (38%), Positives = 13/21 (61%)
 Frame = +1

Query: 400 VWHLWIRQRYQMVWPRTRLNV 462
           V+H+W+R      W RTR+ +
Sbjct: 307 VFHIWVRDATAQEWQRTRIEI 327


>At5g04730.1 68418.m00484 expressed protein ; expression supported
           by MPSS
          Length = 321

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +3

Query: 48  SNDKAPRNILVERGRLELPGPVLEAAGSQDWCSDTRERTARWYRKVEEQI 197
           S DK   NIL   GRL  P  + + +G+    +   +R ++W+++VE  +
Sbjct: 79  SYDKGNNNILHIAGRLSTPDQLSKISGA----ALKMQRESQWFKEVESLV 124


>At4g09400.1 68417.m01549 hypothetical protein similar to At3g45350,
           At2g14330
          Length = 513

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = -1

Query: 457 LSVYGATPFGNVVVSISAKRLNTQRRSHWSALTPVYRSQSCFDNLPNSLPSKLG*GVNF- 281
           LS Y  TPF N++     K +  +      A T ++R Q       +   S+   G ++ 
Sbjct: 116 LSFYNFTPFDNIIEKTVNKNVLVEDGGDSLAATSIFRRQDFSGKRRHFFTSEKSDGFDYY 175

Query: 280 ---GDGSYGASREC 248
               DG++G   +C
Sbjct: 176 NAIRDGNWGIPTKC 189


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,256,904
Number of Sequences: 28952
Number of extensions: 311898
Number of successful extensions: 877
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 859
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 877
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1206913392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).