BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40152 (742 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24850.1 68416.m03117 hypothetical protein contains Pfam prof... 31 1.1 At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) co... 28 7.5 At3g44250.1 68416.m04749 cytochrome P450 family protein CYTOCHRO... 28 7.5 At4g38040.1 68417.m05373 exostosin family protein contains Pfam ... 27 9.9 At2g37950.1 68415.m04658 zinc finger (C3HC4-type RING finger) fa... 27 9.9 At2g22340.1 68415.m02651 hypothetical protein 27 9.9 >At3g24850.1 68416.m03117 hypothetical protein contains Pfam profile PF03754: Domain of unknown function (DUF313) Length = 359 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 102 NTSFKSDTCKS--KLNELPSFATLDDLHLKPSRQKRNPASATQPCRMDTCFDFLNVE 266 N F S T S LN+LP+ + ++D S+ K S+++PC FD+ E Sbjct: 72 NGGFISFTSSSLIDLNQLPTDSEIEDPQTSDSQMKTLQNSSSEPCTSLVLFDYKTAE 128 >At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) contains Pfam profile PF00856: SET domain Length = 1423 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 684 VAAGGTPPFSGCSL*NNGQ*NVKSLTKHYFGSTCSGQYS 568 VA T P G S ++ + V +L +YFGS C G YS Sbjct: 2 VAVDSTFPSHGSSY-SSRRKKVSALEPNYFGSMCMGVYS 39 >At3g44250.1 68416.m04749 cytochrome P450 family protein CYTOCHROME P450 71B7 - Arabidopsis thaliana, EMBL:X97864 Length = 499 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 Query: 602 CFVRDLTFHWPLFHKEHPEKGGVPPAATVQPISGSTEAFG 721 CF+ L LF K P KG +PP PI G+ G Sbjct: 6 CFLLLLPLSLILFKKLLPSKGKLPPGPIGLPIIGNLHQLG 45 >At4g38040.1 68417.m05373 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 425 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +2 Query: 269 DPKIFVYPSDGTVSASYRK---VLSVIRESRYVTRDPNEACLF 388 DP F Y + V+ Y IRESR+ T DP+EA LF Sbjct: 113 DPNTF-YQTPRKVTGKYASEGYFFQNIRESRFRTLDPDEADLF 154 >At2g37950.1 68415.m04658 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger); contains PROSITE PS00190: Cytochrome c family heme-binding site signature Length = 207 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 600 YFGSTCSGQYSFTWVKSQRIFSIVWPSAS 514 YF ST G Y + +S+++ S++ PS+S Sbjct: 41 YFYSTTGGSYEYEGDQSRKVSSVMSPSSS 69 >At2g22340.1 68415.m02651 hypothetical protein Length = 358 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 278 FLDHFHI*KVETCIHTTRLCCRSRIAFLSRWFKV 177 F+ HF V I ++ + CRS + L RW +V Sbjct: 42 FISHFFWISVINMIESSHIRCRSHLIMLIRWNQV 75 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,364,862 Number of Sequences: 28952 Number of extensions: 370848 Number of successful extensions: 1036 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -