BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0299.Seq (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_55418| Best HMM Match : GWT1 (HMM E-Value=1.5) 30 2.6 SB_27872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_35068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_52408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_29018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_24908| Best HMM Match : Transglut_C (HMM E-Value=0.028) 28 8.0 >SB_52311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/102 (19%), Positives = 42/102 (41%) Frame = +2 Query: 329 TVKLINKRDHHALKLIDQQNHNKIAFGDSKDKTSKKVSWKFTPVLENKQSILPRSCPPKT 508 T+ +I++ + + + +I Q N N IA + ++ ++ L N +I + P Sbjct: 16 TIAIISQYNSNTIAIISQYNSNTIAIPSQYHCNTITITLQYHHNLRNTMTIQLQKYPNNI 75 Query: 509 TVPEAR*TRKVLVDEPYHLR**QPLTTFQNNQLGTLEAFHGN 634 T+P+ + + YH + Q N + +H N Sbjct: 76 TIPQQYHRNNIAIPSQYHHNTITIPSRHQQNTITIPSQYHHN 117 >SB_55418| Best HMM Match : GWT1 (HMM E-Value=1.5) Length = 260 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 253 W*AKSMVFLLPFSIRRFTASLITSPFFSFRYSEHLAIAVSYSPMT 119 W + +F++ SI + A+L F F H+ AV+YS T Sbjct: 127 WQSSRFMFIMRLSILSYAAALFHDQGFEFSLGLHILAAVAYSVRT 171 >SB_27872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +3 Query: 162 YLKEKKGEVIKEAVKRLIENGKRNTMDFAYQYGQRME 272 + +E+ GE EA KRLI+ GK+ M F G+R++ Sbjct: 676 FREEEDGESFAEAKKRLIKQGKQQIM-FLLYIGKRIK 711 >SB_35068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +2 Query: 413 SKDKTSKKVS--WKFTPVLENKQSILPRSCP 499 ++D S++ S WK+ L N Q ++P+SCP Sbjct: 57 TEDTRSRRYSLTWKYAMRLNNCQGVVPQSCP 87 >SB_52408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/68 (26%), Positives = 32/68 (47%) Frame = +1 Query: 313 DLHRADCQAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQTEYTSKI 492 DLH + Q +Q G + + + QQ + LQ+Q QQ+ ++ + KQ+ K+ Sbjct: 558 DLHEEEVQHQQQFGLQEQSLGQEQRKQQ---QQLQQQQQQKQQQQLQKKQQKQSSMEEKL 614 Query: 493 MSTEDNST 516 S + T Sbjct: 615 SSEIEKMT 622 >SB_29018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = +3 Query: 426 PARKSPGSLPPCWKT-----NRVYFQDHVHRRQQY 515 PA+ P +LPP WKT ++Y+ + RR Q+ Sbjct: 840 PAKVKPRALPPNWKTATDPQGKIYYYHTLTRRTQW 874 >SB_24908| Best HMM Match : Transglut_C (HMM E-Value=0.028) Length = 202 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/63 (33%), Positives = 28/63 (44%) Frame = +3 Query: 84 DDVLAEQLYMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQYGQ 263 D + ++ VVIG I K + EK+ I VK + G RNT D A Q Sbjct: 29 DVTFSYEVQSDVVIGSDFNVIVKANNKGSEKRSVDISITVKSAMYTG-RNTHDVAKLLRQ 87 Query: 264 RME 272 R+E Sbjct: 88 RVE 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,809,911 Number of Sequences: 59808 Number of extensions: 531775 Number of successful extensions: 1620 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -