BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0272.Seq (793 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 33 0.20 09_04_0202 - 15544498-15545037,15546043-15546449,15546874-155469... 30 2.4 01_03_0206 - 13783169-13783651,13783761-13783903,13783962-137841... 28 9.8 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 284 RCPWSPGAKVIGVLHAVHLVVSYQFV 207 RC WSP ++GV + H+V +Y FV Sbjct: 430 RCLWSPDGSILGVAFSKHIVQTYAFV 455 >09_04_0202 - 15544498-15545037,15546043-15546449,15546874-15546977, 15547580-15547788,15548092-15549428,15551680-15551941 Length = 952 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +3 Query: 453 WKLIALWENNKVYFKILNTNVTNTWYWESALTGTATIWXSEST 581 WK I W + LN + T Y +S L IW +ST Sbjct: 403 WKDIGFWNEGNGILRQLNLGKSTTKYADSVLDLNPVIWPGKST 445 >01_03_0206 - 13783169-13783651,13783761-13783903,13783962-13784128, 13784641-13785149,13786031-13786312,13786397-13786792, 13787232-13787504 Length = 750 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 450 SWKLIALWENNKVYFKILNTNVTNTWYWESALTGTATIWXSESTASIV 593 SW IA + V + N ++ N W+W + GTAT + + +V Sbjct: 516 SWSYIA--NASSVGYAPGNFSMQNNWFWFEKVVGTATPEKDQQDSKVV 561 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,557,386 Number of Sequences: 37544 Number of extensions: 332660 Number of successful extensions: 927 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -