BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesS0018
(678 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF002246-1|AAB60937.1| 1224|Homo sapiens neural cell adhesion mo... 30 6.6
>AF002246-1|AAB60937.1| 1224|Homo sapiens neural cell adhesion
molecule protein.
Length = 1224
Score = 30.3 bits (65), Expect = 6.6
Identities = 15/62 (24%), Positives = 34/62 (54%), Gaps = 3/62 (4%)
Frame = +2
Query: 260 ASVQYEETKRDSC---SVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRS 430
A+V+ ++++ D C + P+ + +Q +P+K SL++ N ++ I I++R
Sbjct: 191 ANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIGSKANSIKQRK 250
Query: 431 PR 436
P+
Sbjct: 251 PK 252
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,560,894
Number of Sequences: 237096
Number of extensions: 1511314
Number of successful extensions: 3959
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3958
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7671262118
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -