BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302D07f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0896 - 12233706-12233801,12234005-12234181,12234741-122348... 165 1e-41 04_04_0827 - 28457858-28458028,28458513-28458669,28458984-284590... 31 0.42 12_02_0647 + 21487932-21488011,21488454-21488472,21488842-21489507 27 9.1 08_01_0507 - 4415086-4415724,4416094-4416112,4416555-4416634 27 9.1 07_03_1041 + 23468867-23469215,23469231-23469348,23470920-234710... 27 9.1 >03_02_0896 - 12233706-12233801,12234005-12234181,12234741-12234854, 12234928-12235006,12235372-12235533,12235957-12236079, 12236139-12236218 Length = 276 Score = 165 bits (402), Expect = 1e-41 Identities = 80/151 (52%), Positives = 103/151 (68%), Gaps = 7/151 (4%) Frame = -3 Query: 519 GHICYFVTAPEEGNDSVVFTGDTLFLGGCGRFFEGTADQMYKALITILSSLPDHTKVFCG 340 GHI Y+VT+ EE D VFTGDTLF+ GCGRFFEGTA+QMY++L L SLP T+V+CG Sbjct: 126 GHISYYVTSKEE-EDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKPTQVYCG 184 Query: 339 HEYTLQNLKFAAHVEPTNENVKAKISWSQDRRNQGKPTVPSTIGEEKLYNPFMRV--TEL 166 HEYT++NLKF VEP NE VK K+ W+Q +R +PT+PSTIGEE N FMRV E+ Sbjct: 185 HEYTVKNLKFILTVEPDNEKVKQKLEWAQKQREANQPTIPSTIGEEFETNTFMRVDLPEI 244 Query: 165 AV-----QNHTGKNDPIDTMKAIRLEKDTFK 88 + Q G P++ ++ +R KD +K Sbjct: 245 QIMPSILQAKFGAKSPVEALREVRKTKDNWK 275 >04_04_0827 - 28457858-28458028,28458513-28458669,28458984-28459083, 28459204-28459231,28459321-28459396,28461276-28461355, 28461642-28461805,28461897-28462056,28462154-28462277, 28462901-28463941,28464141-28464259,28464512-28464823, 28465222-28465425,28466068-28466751,28467301-28467474 Length = 1197 Score = 31.5 bits (68), Expect = 0.42 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Frame = -3 Query: 333 YTLQNLKFAAHVEPTNENVKAKISWSQD----RRNQGKPTVPSTIGEEKLYNPFMRVTEL 166 Y+L N FAA VE E ++ RR +G+P +PS + YN +T L Sbjct: 167 YSLVNQAFAAAVEKVLEGYFCSLNTLPASIKLRRLEGQPDIPSMTPDGASYNSNSEITLL 226 Query: 165 AVQNHT 148 V HT Sbjct: 227 EVYLHT 232 >12_02_0647 + 21487932-21488011,21488454-21488472,21488842-21489507 Length = 254 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 315 KFAAHVEPTNENVKAKISWS 256 +F+A V PT E V +SWS Sbjct: 196 RFSAKVHPTGERVDGSLSWS 215 >08_01_0507 - 4415086-4415724,4416094-4416112,4416555-4416634 Length = 245 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 315 KFAAHVEPTNENVKAKISWS 256 +F+A V PT E V +SWS Sbjct: 196 RFSAKVHPTGERVDGSLSWS 215 >07_03_1041 + 23468867-23469215,23469231-23469348,23470920-23471041, 23471074-23471532,23474675-23474949,23475179-23475315, 23475353-23475405,23475456-23475516,23475606-23475707, 23476380-23476488,23476568-23476693,23476986-23477037, 23477236-23477317,23477395-23477488,23478166-23478262, 23478605-23478698,23479458-23479530,23480198-23480371, 23480526-23480648,23481396-23481533,23482270-23482446 Length = 1004 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 435 CGRFFEGTADQMYKALITILSSLPDHTKVFCGHEYTL 325 CG A ++A + + + L HT++FC E+ L Sbjct: 745 CGPSGSELAPSTFEAFVKVPNVLRPHTQIFCTSEWVL 781 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,542,517 Number of Sequences: 37544 Number of extensions: 261172 Number of successful extensions: 513 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -