BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302C01f (500 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC8E11.10 |||sorbose reductase |Schizosaccharomyces pombe|chr ... 33 0.018 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 31 0.13 SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pomb... 27 1.6 SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 27 1.6 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 1.6 SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 26 2.8 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 26 2.8 SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe... 25 4.8 SPAC4A8.06c |||esterase/lipase |Schizosaccharomyces pombe|chr 1|... 25 6.4 SPBC31F10.04c |srb4|med17|mediator complex subunit Srb4|Schizosa... 25 8.4 SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote... 25 8.4 SPAC12B10.11 |exg2||glucan 1,3-beta-glucosidase Exg2|Schizosacch... 25 8.4 >SPAC8E11.10 |||sorbose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 255 Score = 33.5 bits (73), Expect = 0.018 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 46 MLAASAGVV--ELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSII 201 ++ A+AG+ LS + N+D+ K+ L G Y +A ++ QGKGS+I Sbjct: 91 VMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKKQGKGSLI 144 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 30.7 bits (66), Expect = 0.13 Identities = 15/61 (24%), Positives = 31/61 (50%) Frame = +1 Query: 193 SIIQNVVNNLIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNFRLIMAGNYVKIIYRNYNL 372 +II V+N I+D+ + ++C ++W G + +R ++ N ++ K IY + Sbjct: 247 AIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIRMFYS-NLYKKLSHRDAKSIYHHVRR 305 Query: 373 A 375 A Sbjct: 306 A 306 >SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 27.1 bits (57), Expect = 1.6 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 171 FQALTDSTVVVAGEDAVVQFLLEVLV 94 F +T V+V EDAVV+F+L +LV Sbjct: 181 FLGVTVQYVMVLPEDAVVEFVLTILV 206 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 27.1 bits (57), Expect = 1.6 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Frame = -3 Query: 309 WEVLSNNFLS--VADPQL---VAVLHGVPSLVNDQVVNYILD 199 W+VL +++L+ ++ P V LHGV + VN V +YI D Sbjct: 188 WDVLFHDYLNETLSQPAFSFNVPDLHGVDNKVNQYVFDYIKD 229 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.1 bits (57), Expect = 1.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 94 NQDLEEKLYNSILTGDYDSAVRQSLE 171 + DLE+ + ++LTGD SAV+ LE Sbjct: 551 DSDLEKNITEALLTGDVLSAVKACLE 576 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.2 bits (55), Expect = 2.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 59 ARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAW 169 AR SLNY ++ + SRRN ++P S + W Sbjct: 622 ARESLNYLKSFNKQLSRRNAPDINNPIADFQNSFQNW 658 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.2 bits (55), Expect = 2.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 196 IIQNVVNNLIIDKRRNTMEYCYKLWVGNGQEIVR 297 +++++ NL I N +EY LW NG I + Sbjct: 447 VLKDIFFNLQIGVTFNILEYLRHLWSNNGDAIAK 480 >SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe|chr 1|||Manual Length = 371 Score = 25.4 bits (53), Expect = 4.8 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 Query: 20 NFSLYLRCACSPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRA 166 N S + C SP A A + P+TL T ASS T+ + V A Sbjct: 242 NDSFMVGCIYSP-AEAKEHVPKTLRNSNKDLEMTDASSSETSMSIPVHA 289 >SPAC4A8.06c |||esterase/lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 25.0 bits (52), Expect = 6.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 279 VADPQLVAVLHGVPSLVNDQVVNYILDDG 193 V D V + H +PS+V D +YI +G Sbjct: 239 VYDSPWVDLTHSLPSVVADDAADYIPSEG 267 >SPBC31F10.04c |srb4|med17|mediator complex subunit Srb4|Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 157 RQSLEYESQGKGSIIQNVVNNLIIDKRRN 243 ++S++ ES K S +NV+ +D +RN Sbjct: 62 KESIKDESSAKSSETENVLEFATLDSKRN 90 >SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 592 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 375 SEVVVSVNDLDIVSGHDE 322 SE+VVSVN LD++S ++ Sbjct: 316 SEIVVSVNKLDLMSWSED 333 >SPAC12B10.11 |exg2||glucan 1,3-beta-glucosidase Exg2|Schizosaccharomyces pombe|chr 1|||Manual Length = 570 Score = 24.6 bits (51), Expect = 8.4 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +1 Query: 331 AGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWETPS 492 AG Y I+ Y+ +++ P NE YG + L W + + TPS Sbjct: 125 AGLYTMGIFDKYDDSVQANPNVPPLNEPFPYGRLPIRGVNLGGWLSMEPFITPS 178 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,058,523 Number of Sequences: 5004 Number of extensions: 40889 Number of successful extensions: 132 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -