BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302A08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42230| Best HMM Match : PFK (HMM E-Value=0) 78 4e-15 SB_52724| Best HMM Match : adh_short (HMM E-Value=5.1e-08) 31 0.76 SB_58080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) 30 1.0 SB_51649| Best HMM Match : PAN (HMM E-Value=0.063) 29 2.3 SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38098| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_51718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_31260| Best HMM Match : rve (HMM E-Value=5.2e-25) 28 5.4 SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) 28 5.4 SB_35603| Best HMM Match : DUF1309 (HMM E-Value=0.51) 27 7.1 SB_14616| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_52091| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 27 9.4 SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 27 9.4 SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) 27 9.4 SB_15486| Best HMM Match : rve (HMM E-Value=1.2e-09) 27 9.4 SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_42230| Best HMM Match : PFK (HMM E-Value=0) Length = 1103 Score = 78.2 bits (184), Expect = 4e-15 Identities = 40/71 (56%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Frame = +1 Query: 193 GMNAAVRSVVRMGIYLGCKVYFIREGYQGMVDGGDNIEEANWSSVSSIIHK---GGTIIG 363 GMNAA+R+VVRM +Y G KVY I EGYQG+VDGGDNI+E W VS II + GG G Sbjct: 598 GMNAAIRAVVRMAMYTGAKVYTIWEGYQGLVDGGDNIKEVTWEDVSGIIQQVVIGGD--G 655 Query: 364 SARCMEFIKKE 396 S + K+E Sbjct: 656 SLTGANYFKQE 666 >SB_52724| Best HMM Match : adh_short (HMM E-Value=5.1e-08) Length = 316 Score = 30.7 bits (66), Expect = 0.76 Identities = 26/78 (33%), Positives = 36/78 (46%) Frame = +1 Query: 202 AAVRSVVRMGIYLGCKVYFIREGYQGMVDGGDNIEEANWSSVSSIIHKGGTIIGSARCME 381 AA+R+VV + + L VYFIRE QG V EA + II T IG ++ Sbjct: 2 AALRNVVIV-VVLAIAVYFIREHCQGRV----CTSEARLDGKTVIITGATTGIGKETAVD 56 Query: 382 FIKKEGRLKAAYNLMSRG 435 K+ R+ + RG Sbjct: 57 LAKRGARVIIGARNLDRG 74 >SB_58080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/53 (33%), Positives = 31/53 (58%) Frame = +2 Query: 17 EA*LHNIEKLKTI*ISYLLLRTTIF*LPRWTGQLLRNLLAAALIKARGLLCLL 175 EA L+ + ++KT I L R + + R+ GQ +RN + A ++ + GL+ LL Sbjct: 20 EAVLYPLHRIKTA-IGRCLHREEVRQIKRFLGQEIRNDILAKVVNSEGLMSLL 71 >SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) Length = 212 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +2 Query: 191 RE*MPLCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTGLLLAL*FT 343 R+ + LCD + G KY+L V D + V+ LK +TG L FT Sbjct: 5 RQQVDLCDMQAFHRHNEGFKYLLTVIDLLSKFAWVVPLKDKTGASLVAAFT 55 >SB_51649| Best HMM Match : PAN (HMM E-Value=0.063) Length = 323 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 340 HKGGTIIGSARCMEFIKKEGRLKAAYNLMSRGITNLVVI 456 ++ T + S C++++K+ YN+ G+T+LV + Sbjct: 80 YRENTAVESKSCLDYLKRGAADNGVYNIHVEGVTHLVPV 118 >SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 498 VGTKLAPVSEPSPPNNHKIGYTTA 427 V T L+PV E SP N GY TA Sbjct: 286 VETPLSPVKEESPSTNKTFGYQTA 309 >SB_38098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G KY+L V D + V++LK +TG Sbjct: 110 LCDVQSLSSYNNGNKYLLTVIDVLSKYALVVSLKDKTG 147 >SB_51082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1529 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G KYIL V D + + LK +TG Sbjct: 149 LCDMQSLSSYNDGYKYILSVIDVLSKYGWAVALKDKTG 186 >SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2337 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK +TG Sbjct: 1024 LCDMQALRSYNDGYNYLLIVIDLLSKYAWVVPLKDKTG 1061 >SB_57035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK +TG Sbjct: 255 LCDMQALRSYNDGYNYLLTVIDVLSKYAWVVPLKDKTG 292 >SB_51718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1602 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK +TG Sbjct: 117 LCDMQALRSYNDGYNYLLTVIDVLSKYAWVVPLKDKTG 154 >SB_31260| Best HMM Match : rve (HMM E-Value=5.2e-25) Length = 1962 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK +TG Sbjct: 641 LCDMQALRSYNDGYNYLLTVIDVLSKYAWVVPLKDKTG 678 >SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK +TG Sbjct: 764 LCDMQALRSYNDGYNYLLTVIDVLSKYAWVVPLKDKTG 801 >SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) Length = 486 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 85 NILITTMDGSATQKFIGRGSHKGKGLAVFTSGGDSQGMNAAVRSVVR-MGIYLGCKVYFI 261 NIL + A KF+ + K K +++ SG G A + V+R M C V FI Sbjct: 211 NILCRDTEIKAVTKFLEKHVQKKKPGSLYISGAPGTGKTACLTMVIRDMKEVSDCPVTFI 270 >SB_35603| Best HMM Match : DUF1309 (HMM E-Value=0.51) Length = 78 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -1 Query: 293 PPSTMPWYPSRIKYTLHPKYMPIRTT--DRTA 204 PP+ +PW YT+ PK P + + DR A Sbjct: 26 PPTKLPWETQAPAYTMRPKTQPEKDSGGDRVA 57 >SB_14616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1307 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK +TG Sbjct: 599 LCDMQALRSYNDGYNYLLTVIDVLSNYAWVVPLKDKTG 636 >SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -1 Query: 293 PPSTMPWYPSRIKYTLHPKYMPIRTT--DRTA 204 PP+ +PW YT+ PK P + + DR A Sbjct: 52 PPTKLPWETQAPAYTMRPKTQPEKDSGGDRVA 83 >SB_52091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1775 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 +CD + +Y G Y+L V D + V+ LK +TG Sbjct: 990 MCDMQALRSYNDGYNYLLTVIDVLSKYAWVVPLKDKTG 1027 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTGLLLAL*FT 343 LCD GVKY+L V D + V+ LK +TG L FT Sbjct: 13 LCDLQAFRRDNDGVKYLLTVIDVLSKFAWVVPLKDKTGSSLVEAFT 58 >SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 333 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 184 DSQGMNAAVR--SVVRMGIYLGCKVYFIREGYQGMVD 288 + Q + AVR ++ R IY+ KVYF GY+ +D Sbjct: 111 NEQSVGEAVRCSNIPRCEIYVVTKVYFTEHGYKETMD 147 >SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 657 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK ++G Sbjct: 146 LCDMQALRSYNDGYNYLLIVIDVLSKYAWVVPLKDKSG 183 >SB_15486| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 662 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D + V+ LK ++G Sbjct: 146 LCDMQALRSYNDGYNYLLIVIDVLSKYAWVVPLKDKSG 183 >SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 206 LCDQSCVWAYT*GVKYILFVKDTRAW*MEVITLKKRTG 319 LCD + +Y G Y+L V D V+ LK +TG Sbjct: 149 LCDMQALRSYNEGYNYLLTVIDVLKKYAWVVLLKDKTG 186 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,465,092 Number of Sequences: 59808 Number of extensions: 303278 Number of successful extensions: 977 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -