BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301H11f (366 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 4.7 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 4.7 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 22.6 bits (46), Expect = 4.7 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 190 ALALGVERTKSELIPFLTETIYDEDEVLLALAEQLGSFINLV 315 A+ LGV+ T +L F ++D E Q F+NL+ Sbjct: 233 AVKLGVKVTDDDLEAFFMNLVHDTVEHRERNGVQRNDFLNLL 274 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 58 ELCLDFNSKYTHSNFND 8 E LD N +YTHS D Sbjct: 328 ECHLDHNGRYTHSTTQD 344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 314,716 Number of Sequences: 2352 Number of extensions: 4358 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27514560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -