BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30131 (658 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000382587 Cluster: COG0583: Transcriptional regulat... 34 2.6 UniRef50_P25769 Cluster: Uncharacterized protein in nifH1 5'regi... 34 3.5 UniRef50_UPI0000F1E6CE Cluster: PREDICTED: hypothetical protein;... 33 4.6 UniRef50_Q64SN4 Cluster: Putative cysteine proteases; n=2; Bacte... 33 6.0 UniRef50_Q2KYL1 Cluster: Putative exported protein precursor; n=... 33 8.0 UniRef50_Q7SHW3 Cluster: Putative uncharacterized protein NCU006... 33 8.0 UniRef50_Q2M3G4 Cluster: Protein Shroom1; n=12; Eutheria|Rep: Pr... 33 8.0 >UniRef50_UPI0000382587 Cluster: COG0583: Transcriptional regulator; n=1; Magnetospirillum magnetotacticum MS-1|Rep: COG0583: Transcriptional regulator - Magnetospirillum magnetotacticum MS-1 Length = 181 Score = 34.3 bits (75), Expect = 2.6 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 356 RPCASPADYTRWSLQTPTSARAKRAP 279 RPCASPA RW PT+A RAP Sbjct: 22 RPCASPAFVERWFPDGPTAAALSRAP 47 >UniRef50_P25769 Cluster: Uncharacterized protein in nifH1 5'region; n=1; Methanothermococcus thermolithotrophicus|Rep: Uncharacterized protein in nifH1 5'region - Methanococcus thermolithotrophicus Length = 97 Score = 33.9 bits (74), Expect = 3.5 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -2 Query: 210 LLVRSNTIRPIDYPYSSFHHNLSLLFII 127 L+ SNTI+P+ YPYS+ N S+LFII Sbjct: 48 LMHNSNTIKPLIYPYSNLRDN-SILFII 74 >UniRef50_UPI0000F1E6CE Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1235 Score = 33.5 bits (73), Expect = 4.6 Identities = 39/132 (29%), Positives = 50/132 (37%), Gaps = 10/132 (7%) Frame = -1 Query: 478 SGIAYRNSDQTKLPSKNI*RHGSPADQQSQLPS*CASTAWIARVHHP---LTTHDGLYRP 308 S + R+ D L RHG A S S + I R P + T G + P Sbjct: 1022 SASSERSQDDESLMGSRSDRHGDDALSLSSSSSPLLRKSKIPRPVTPTSSMETLTGQFMP 1081 Query: 307 RPPPEPNAHRAPTDYLSCLKRHRFLPG----YDYVIATGTVEH--NTADRLSLLEFSPQF 146 RPPP R+ D L+R+R G D + + H +T SPQ Sbjct: 1082 RPPPGKPPSRSNVD--GRLRRYRIRAGSTSDSDLLTCLAQLMHASSTHGSPQHSSSSPQH 1139 Query: 145 KLALH-HHHLHQ 113 A H HHLHQ Sbjct: 1140 VSARHIFHHLHQ 1151 >UniRef50_Q64SN4 Cluster: Putative cysteine proteases; n=2; Bacteroides fragilis|Rep: Putative cysteine proteases - Bacteroides fragilis Length = 446 Score = 33.1 bits (72), Expect = 6.0 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Frame = -1 Query: 340 PLTTHDGLYRPRP--PPEPNAHRAPTDYLSCLKRHRFLPG--YDYVIATGTVEHNTADRL 173 P H LY + P EP +Y SC + H PG Y A + TA+R Sbjct: 194 PSCRHSTLYMEKQAIPGEPTVFSETFEYTSCAEWHPLKPGNILPYDTAGALYKEYTAERE 253 Query: 172 SLLEFSPQFK 143 + + F+P+ K Sbjct: 254 THIRFTPRIK 263 >UniRef50_Q2KYL1 Cluster: Putative exported protein precursor; n=1; Bordetella avium 197N|Rep: Putative exported protein precursor - Bordetella avium (strain 197N) Length = 628 Score = 32.7 bits (71), Expect = 8.0 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -3 Query: 359 DRPCASPADYTRWSLQTPTSARAKRAPRTHGLLELPQETPISTGLRL 219 D P SPAD TRW+ + T RA R G + L + +S GL L Sbjct: 562 DLPVPSPADITRWNEEYQTFGRASINKR--GKVVLQNDVDVSDGLSL 606 >UniRef50_Q7SHW3 Cluster: Putative uncharacterized protein NCU00691.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU00691.1 - Neurospora crassa Length = 794 Score = 32.7 bits (71), Expect = 8.0 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -2 Query: 576 LTKSNNRVYKVHYSAARARTTVVHQTSNLLCTNQA*LTGTQIKQNF-RVKISNATALQPT 400 LT S ++ ++AR+ T V HQ SN +C+N + TGT+ SN++A P Sbjct: 66 LTDSLGNPTALNATSARSSTLVAHQRSNTICSNDS-TTGTETATGTDNDMASNSSAAMPA 124 Query: 399 S 397 + Sbjct: 125 T 125 >UniRef50_Q2M3G4 Cluster: Protein Shroom1; n=12; Eutheria|Rep: Protein Shroom1 - Homo sapiens (Human) Length = 852 Score = 32.7 bits (71), Expect = 8.0 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 412 SPADQQSQLPS*CASTAWIARVHHPLTTHDG-LYRPRPPPEPNAHRAP 272 SPAD + ++ C AW+ + + + L R R PP+P+A + P Sbjct: 364 SPADSEQRVSETCIVPAWLPSLPDEVFLEEAPLVRMRSPPDPHASQGP 411 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,939,325 Number of Sequences: 1657284 Number of extensions: 13588627 Number of successful extensions: 44290 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 41580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44145 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49586781480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -