BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D24 (907 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 4.3 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 7.6 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 531 MGEHIKDIVILSSITQVLALINNYFWLLLLILPIRVFWLLW 653 + +HI +I + + VL L L ++P RVF +LW Sbjct: 273 LNKHIDNISLRARKQVVLMLGTVVLSFFLCLIPFRVF-ILW 312 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 344 FYGIITALFYYENISNWVLFFN 409 F+ +T++ + + S W LF N Sbjct: 100 FHSFMTSVLFSQVASRWPLFLN 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,619 Number of Sequences: 336 Number of extensions: 4157 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -