BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0147 (586 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0947 + 24680119-24681497,24682213-24682275,24683380-246842... 28 4.8 04_03_0612 + 18023354-18023916,18024046-18024805 28 6.3 >12_02_0947 + 24680119-24681497,24682213-24682275,24683380-24684239, 24684399-24684772,24685932-24686112,24686201-24686220 Length = 958 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 296 KVVASSSTAVKQDYNEYMWTMRKEFSEPEPSIIVEQDNITNFSKE 430 K SS+ + Q + + TM +EP +VE NI+ SKE Sbjct: 849 KASFSSNASYPQGGDLWQGTMANHSAEPSKHFVVESSNISEQSKE 893 >04_03_0612 + 18023354-18023916,18024046-18024805 Length = 440 Score = 27.9 bits (59), Expect = 6.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +2 Query: 131 LLRTQKSLARVSVWLESGRYRRTQEICVRRLL*QFHNSLLTNPCVILSALEV 286 L ++ K+L +S+W+ G Y I R L LTN C +L +E+ Sbjct: 244 LSQSCKNLKSISLWMIPGLYHEPDGIVFRTDLTDESLEALTNNCPLLQDVEL 295 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,887,550 Number of Sequences: 37544 Number of extensions: 247252 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -