BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0140 (717 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g36880.1 68418.m04418 acetyl-CoA synthetase, putative / aceta... 80 1e-15 At5g35930.1 68418.m04322 AMP-dependent synthetase and ligase fam... 33 0.19 At1g58360.1 68414.m06638 amino acid permease I (AAP1) identical ... 31 0.58 At3g16170.1 68416.m02041 acyl-activating enzyme 13 (AAE13) simil... 31 0.76 At5g16370.1 68418.m01913 AMP-binding protein, putative similar t... 31 1.0 At5g16340.1 68418.m01910 AMP-binding protein, putative similar t... 31 1.0 At1g75960.1 68414.m08822 AMP-binding protein, putative similar t... 30 1.3 At1g21540.1 68414.m02694 AMP-binding protein, putative strong si... 30 1.8 At1g21530.1 68414.m02693 AMP-binding protein, putative strong si... 30 1.8 At5g49630.1 68418.m06141 amino acid permease 6 (AAP6) identical ... 29 2.3 At5g45330.1 68418.m05564 expressed protein ; expression supporte... 29 2.3 At2g17650.1 68415.m02042 AMP-dependent synthetase and ligase fam... 29 2.3 At4g14070.1 68417.m02172 AMP-binding protein, putative similar t... 29 3.1 At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, puta... 29 3.1 At4g05160.1 68417.m00775 4-coumarate--CoA ligase, putative / 4-c... 29 3.1 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 3.1 At3g23790.1 68416.m02990 AMP-binding protein, putative similar t... 29 4.1 At1g65890.1 68414.m07477 acyl-activating enzyme 12 (AAE12) simil... 28 5.4 At1g65880.1 68414.m07476 AMP-dependent synthetase and ligase fam... 28 5.4 At1g30520.1 68414.m03734 acyl-activating enzyme 14 (AAE14) ident... 28 5.4 At4g35280.1 68417.m05013 zinc finger (C2H2 type) family protein ... 28 7.1 At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containi... 28 7.1 At3g48990.1 68416.m05351 AMP-dependent synthetase and ligase fam... 28 7.1 At1g66120.1 68414.m07504 acyl-activating enzyme 11 (AAE11) simil... 28 7.1 At1g64400.1 68414.m07299 long-chain-fatty-acid--CoA ligase, puta... 28 7.1 At1g01480.2 68414.m00064 1-aminocyclopropane-1-carboxylate synth... 28 7.1 At1g01480.1 68414.m00063 1-aminocyclopropane-1-carboxylate synth... 28 7.1 At5g54860.1 68418.m06834 integral membrane transporter family pr... 27 9.4 At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / lon... 27 9.4 At1g68270.1 68414.m07798 AMP-dependent synthetase and ligase fam... 27 9.4 At1g49430.1 68414.m05541 long-chain-fatty-acid--CoA ligase / lon... 27 9.4 >At5g36880.1 68418.m04418 acetyl-CoA synthetase, putative / acetate-CoA ligase, putative similar to SP|P27550 (Escherichia coli) and gi:8439651 (Homo sapiens); contains Pfam AMP-binding enzyme domain PF00501 Length = 693 Score = 80.2 bits (189), Expect = 1e-15 Identities = 32/70 (45%), Positives = 49/70 (70%) Frame = +3 Query: 264 VWWAASDLGWVVGHSYICYGPLLAGMTSVLYEGKPDRTPDPGQYFRIIEQHRVNALFTIP 443 V+W +D GW+ GHSY+ YGP+L G T V++EG P+ PDPG+ + I+++++V+ +T P Sbjct: 346 VYWCTADCGWITGHSYVTYGPMLNGATVVVFEGAPN-YPDPGRCWDIVDKYKVSIFYTAP 404 Query: 444 TAFRVLKRAD 473 T R L R D Sbjct: 405 TLVRSLMRDD 414 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +1 Query: 73 GRDISWDEGLEADPVPCES--VEANEPLYILYTSGTTDAPKGVQRPCG 210 GRD+ W + + P CE V+A +PL++LYTSG+T PKGV G Sbjct: 278 GRDVWWQDVISQYPTSCEVEWVDAEDPLFLLYTSGSTGKPKGVLHTTG 325 >At5g35930.1 68418.m04322 AMP-dependent synthetase and ligase family protein similar to iturin A synthetase C [Bacillus subtilis] GI:16040972; contains Pfam profile PF00501: AMP-binding enzyme Length = 1040 Score = 33.1 bits (72), Expect = 0.19 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 58 CPL---EIGRDISWDEGLEADPVPCESVEANEPLYILYTSGTTDAPKGV 195 CP+ + +S + G + PC+ + Y++YTSG+T PKGV Sbjct: 72 CPVLLFSMDEKLSVETGCSSFVWPCKKERQRKFCYLMYTSGSTGKPKGV 120 >At1g58360.1 68414.m06638 amino acid permease I (AAP1) identical to amino acid permease I GI:22641 from [Arabidopsis thaliana] Length = 485 Score = 31.5 bits (68), Expect = 0.58 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +3 Query: 180 RPKRSSTSLRPRSHALL-VHEKGVWSQRXVWWAASDLGWVVGHSYICYGPLLAGMTSVLY 356 R KR+ T L +H + V GV S + WA + LGW+ G S + + TS + Sbjct: 34 REKRTGTWLTASAHIITAVIGSGVLS---LAWAIAQLGWIAGTSILLIFSFITYFTSTML 90 Query: 357 EGKPDRTPDP 386 R PDP Sbjct: 91 -ADCYRAPDP 99 >At3g16170.1 68416.m02041 acyl-activating enzyme 13 (AAE13) similar to malonyl CoA synthetase GB:AAF28840 from [Bradyrhizobium japonicum]; contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA acyl-activating enzyme 13 (At3g16170) GI:29893232, acyl-activating enzyme 13 [Arabidopsis thaliana] GI:29893233 Length = 544 Score = 31.1 bits (67), Expect = 0.76 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 109 DPVPCESVEANEPLYILYTSGTTDAPKGV 195 D E ++P I+YTSGTT PKGV Sbjct: 160 DSFEAEGKFLDDPALIVYTSGTTGKPKGV 188 >At5g16370.1 68418.m01913 AMP-binding protein, putative similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA adenosine monophosphate binding protein 5 AMPBP5 (AMPBP5) GI:20799718 Length = 552 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ + YTSGTT APKGV Sbjct: 186 DPVVLNYTSGTTSAPKGV 203 >At5g16340.1 68418.m01910 AMP-binding protein, putative similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to adenosine monophosphate binding protein 6 AMPBP6 (AMPBP6) GI:20799720 Length = 550 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ + YTSGTT APKGV Sbjct: 186 DPVVLNYTSGTTSAPKGV 203 >At1g75960.1 68414.m08822 AMP-binding protein, putative similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam profile: PF00501 AMP-binding enzyme; identical to cDNA adenosine monophosphate binding protein 8 AMPBP8 (AMPBP8) GI:20799724 Length = 544 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ + YTSGTT +PKGV Sbjct: 185 DPIVVNYTSGTTSSPKGV 202 >At1g21540.1 68414.m02694 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA adenosine monophosphate binding protein 9 AMPBP9 (AMPBP9) GI:20799726 Length = 550 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ + YTSGTT +PKGV Sbjct: 188 QPMILNYTSGTTSSPKGV 205 >At1g21530.1 68414.m02693 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA adenosine monophosphate binding protein 10 AMPBP10 (AMPBP10) GI:20799728 Length = 547 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ + YTSGTT +PKGV Sbjct: 185 QPMVLNYTSGTTSSPKGV 202 >At5g49630.1 68418.m06141 amino acid permease 6 (AAP6) identical to amino acid permease 6 (AAP6) [Arabidopsis thaliana] GI:1769887 Length = 481 Score = 29.5 bits (63), Expect = 2.3 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +3 Query: 180 RPKRSSTSLRPRSHALL-VHEKGVWSQRXVWWAASDLGWVVGHSYICYGPLLAGMTSVLY 356 R KR+ T + +H + V GV S + WA + LGWV G + + + TS + Sbjct: 30 RDKRTGTWMTGSAHIITAVIGSGVLS---LAWAIAQLGWVAGPAVLMAFSFITYFTSTML 86 Query: 357 EGKPDRTPDP 386 R+PDP Sbjct: 87 -ADCYRSPDP 95 >At5g45330.1 68418.m05564 expressed protein ; expression supported by MPSS Length = 571 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 611 GQNGNQGSPDHLQPLPWVYGRSNSRGPPLXSG 706 GQ NQ P+H++ +P +G + R PPL G Sbjct: 497 GQQHNQ-FPEHMRQVPEAFGNNFQRPPPLQPG 527 >At2g17650.1 68415.m02042 AMP-dependent synthetase and ligase family protein similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA adenosine monophosphate binding protein 2 AMPBP2 (AMPBP2) GI:20799712 Length = 603 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ I YTSGTT PKGV Sbjct: 242 DPISINYTSGTTSRPKGV 259 >At4g14070.1 68417.m02172 AMP-binding protein, putative similar to AMP-binding protein [gi:1617272] from Brassica napus; contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA acyl-CoA synthetase-like protein GI:20799730 Length = 727 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 130 VEANEPLYILYTSGTTDAPKGV 195 +++++ I+YTSGTT PKGV Sbjct: 276 IDSDDTAAIMYTSGTTGNPKGV 297 >At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, putative / long-chain acyl-CoA synthetase, putative similar to acyl-CoA synthetase (MF7P) gi:1617270 from Brassica napus Length = 666 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 85 SWDEGLEADPVPCESVEANEP---LYILYTSGTTDAPKGV 195 SWDE L+ + +P I+YTSGTT PKGV Sbjct: 202 SWDEFLKLGEGKQYELPIKKPSDICTIMYTSGTTGDPKGV 241 >At4g05160.1 68417.m00775 4-coumarate--CoA ligase, putative / 4-coumaroyl-CoA synthase, putative similar to 4CL2 [gi:12229665] from Arabidopsis thaliana, 4CL1 [gi:12229631] from Nicotiana tabacum; contains Pfam AMP-binding enzyme domain PF00501; acyl-activating enzyme superfamily; identical to cDNA 4-coumarate-CoA ligase-like protein (At4g05160) GI:29893226 Length = 544 Score = 29.1 bits (62), Expect = 3.1 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 6/58 (10%) Frame = +1 Query: 82 ISWDEGLE-ADPV---PCESVEANEPLYILYTSGTTDAPKGVQRPCGH--AATLCWSM 237 +S+D +E ++PV P ++ ++ +LY+SGTT KGV+ G+ AA+L +M Sbjct: 167 LSFDNVMELSEPVSEYPFVEIKQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTM 224 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 145 PLYILYTSGTTDAPKGV 195 P+ + YTSGTT +PKGV Sbjct: 187 PMVLNYTSGTTSSPKGV 203 >At3g23790.1 68416.m02990 AMP-binding protein, putative similar to AMP-binding protein GB:CAA96521 from [Brassica napus] (Plant Mol. Biol. (1997) 33 (5), 911-922); contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA acyl-CoA synthetase-like protein GI:20799732 Length = 722 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 124 ESVEANEPLYILYTSGTTDAPKGV 195 E ++ ++ I+YTSGTT PKGV Sbjct: 258 EYIDPDDIATIMYTSGTTGNPKGV 281 >At1g65890.1 68414.m07477 acyl-activating enzyme 12 (AAE12) similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA acyl-activating enzyme 12 (At1g65890) mRNA GI:29893228, acyl-activating enzyme 12 [Arabidopsis thaliana] GI:29893229 Length = 578 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 133 EANEPLYILYTSGTTDAPKGV 195 + ++P+ + YTSGTT PKGV Sbjct: 184 DEHDPISLNYTSGTTADPKGV 204 >At1g65880.1 68414.m07476 AMP-dependent synthetase and ligase family protein similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 580 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 133 EANEPLYILYTSGTTDAPKGV 195 + ++P+ + YTSGTT PKGV Sbjct: 184 DEHDPISLNYTSGTTADPKGV 204 >At1g30520.1 68414.m03734 acyl-activating enzyme 14 (AAE14) identical to acyl-activating enzyme 14 [Arabidopsis thaliana]; similar to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana}; contains Pfam profile PF00501: AMP-binding enzyme; identical to cDNA acyl-activating enzyme 14 (At1g30520) GI:29893263 Length = 560 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 136 ANEPLYILYTSGTTDAPKGVQRPCGHAATLCWSMKKV 246 +++ + I +TSGTT PKGV H A + S+ K+ Sbjct: 171 SDDAVVICFTSGTTGRPKGV--TISHLAFITQSLAKI 205 >At4g35280.1 68417.m05013 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 284 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 178 DAPKGVQRPCGHAATLCWSMKKVYGLNXECGGRRQTWAG 294 +APK + RPC WS K ++G + C RQ W G Sbjct: 71 NAPK-ITRPCTECGRKFWSWKALFG-HMRCHPERQ-WRG 106 >At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containing protein glutamine-rich tetratricopeptide repeat (TPR) containing protein (SGT) - Rattus norvegicus,PID:e1285298 (SP|O70593); contains Pfam profile PF00515 TPR Domain Length = 426 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 583 EDTFSPIALVSLVTMLSSNE 524 +D+F PI+LV+L T L +NE Sbjct: 59 DDSFKPISLVNLFTSLDNNE 78 >At3g48990.1 68416.m05351 AMP-dependent synthetase and ligase family protein similar to peroxisomal-coenzyme A synthetase (FAT2) [gi:586339] from Saccharomyces cerevisiae; contains Pfam AMP-binding enzyme domain PF00501; identical to cDNA; identical to cDNA adenosine monophosphate binding protein 3 AMPBP3 (AMPBP3)GI:20799714 Length = 514 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 157 LYTSGTTDAPKGVQRPCGHAATLCWSMKKVYGL 255 L+TSGTT PKGV + A+ ++K VY L Sbjct: 168 LHTSGTTSRPKGVPLTQLNLASSVKNIKAVYKL 200 >At1g66120.1 68414.m07504 acyl-activating enzyme 11 (AAE11) similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA acyl-activating enzyme 11 (At1g66120) GI:29893230, acyl-activating enzyme 11 [Arabidopsis thaliana] GI:29893231 Length = 572 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 139 NEPLYILYTSGTTDAPKGV 195 ++P+ + YTSGTT PKGV Sbjct: 186 HDPISLNYTSGTTADPKGV 204 >At1g64400.1 68414.m07299 long-chain-fatty-acid--CoA ligase, putative / long-chain acyl-CoA synthetase, putative similar to GI:1617270 (MF7P) from [Brassica napus] Length = 665 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 85 SWDEGL---EADPVPCESVEANEPLYILYTSGTTDAPKGV 195 SWD+ L E ++ I+YTSGTT PKGV Sbjct: 202 SWDQFLKLGEGKHYELPEKRRSDVCTIMYTSGTTGDPKGV 241 >At1g01480.2 68414.m00064 1-aminocyclopropane-1-carboxylate synthase 2 / ACC synthase 2 (ACS2) (ACC1) identical to 1-aminocyclopropane-1-carboxylate synthase SP|Q06402 [GI:166578] from [Arabidopsis thaliana] Length = 390 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 76 RDISWDEGLEADPVPCES 129 RD+ W G+E PVPC S Sbjct: 52 RDLRWRTGVEIIPVPCSS 69 >At1g01480.1 68414.m00063 1-aminocyclopropane-1-carboxylate synthase 2 / ACC synthase 2 (ACS2) (ACC1) identical to 1-aminocyclopropane-1-carboxylate synthase SP|Q06402 [GI:166578] from [Arabidopsis thaliana] Length = 496 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 76 RDISWDEGLEADPVPCES 129 RD+ W G+E PVPC S Sbjct: 158 RDLRWRTGVEIIPVPCSS 175 >At5g54860.1 68418.m06834 integral membrane transporter family protein contains 10 transmembrane domains; contains Pfam PF03092: BT1 family; contains TIGRFAMS TIGR00788: folate/biopterin transporter; similar to high affinity folic acid/methotrexate transporter 5 (GI:21898554) [Leishmania tarentolae] Length = 491 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = +1 Query: 229 WSMKKVYGLNXEC---GGRRQTWAGWSVIRTFATVRSWL 336 WS+K +YG+ +C GG+++T + VI T ++ WL Sbjct: 63 WSIKPLYGIISDCIPIGGKKRT--PYLVISTVLSLVPWL 99 >At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / long-chain acyl-CoA synthetase nearly identical to acyl-CoA synthetase (MF7P) from Brassica napus [gi:1617270] Length = 666 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 85 SWDEGL---EADPVPCESVEANEPLYILYTSGTTDAPKGV 195 +WDE L E + ++ I+YTSGTT PKGV Sbjct: 202 AWDEFLKLGEGKQYDLPIKKKSDICTIMYTSGTTGDPKGV 241 >At1g68270.1 68414.m07798 AMP-dependent synthetase and ligase family protein similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 535 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 142 EPLYILYTSGTTDAPKGV 195 +P+ + YTSGTT PKGV Sbjct: 187 DPISLNYTSGTTADPKGV 204 >At1g49430.1 68414.m05541 long-chain-fatty-acid--CoA ligase / long-chain acyl-CoA synthetase nearly identical to acyl CoA synthetase (MF45P) GI:1617268 from [Brassica napus] Length = 665 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 154 ILYTSGTTDAPKGV 195 I+YTSGTT PKGV Sbjct: 228 IMYTSGTTGEPKGV 241 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,017,916 Number of Sequences: 28952 Number of extensions: 425359 Number of successful extensions: 1126 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -