BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0138 (694 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosacch... 27 2.6 SPBC947.05c |||ferric-chelate reductase |Schizosaccharomyces pom... 27 3.4 >SPBC13G1.10c |mug81||ATP-dependent RNA helicase Slh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1935 Score = 27.1 bits (57), Expect = 2.6 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 321 LLNLNHEVVLLTKNVVLLCIPKKINFN 401 LLN+N +++ LTKNV+ L + NFN Sbjct: 990 LLNINVDLLPLTKNVLRLVLNITPNFN 1016 >SPBC947.05c |||ferric-chelate reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 3 LNKFLLFIMMLNKTIDGLVIENSKMYLFTLMFFEIPY 113 LN F + + + T G E +YL T +F + PY Sbjct: 368 LNSFKSYAVEIENTAQGHTYEPEDLYLETTVFMDGPY 404 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,788,448 Number of Sequences: 5004 Number of extensions: 57980 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -