BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0130 (626 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.0 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 4.5 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 6.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.9 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 7.9 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 532 PCRGRCVVKQCFLVVRLEGPCCHQHAGQE 446 P GRCV QC GP C A E Sbjct: 606 PDHGRCVCGQCECREGWTGPACDCRASNE 634 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -2 Query: 589 FERDASPLVHDVFPFLEYRPCRGRCVVKQCFLVVRLEGPCC 467 FE+ +P V D RG C+ QC+ EG C Sbjct: 517 FEQCVAPSVGDELRTGPICSDRGECICGQCYCNPGFEGEHC 557 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 6.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 575 KPISP*RVPVPGIPTMSGP 519 +P P PVPG+P M+ P Sbjct: 89 QPRQPMGPPVPGVPIMTTP 107 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 135 AGPREAASSTRHDVKKNCILSDS 67 +GP + +S T K+NC+ S + Sbjct: 1686 SGPNDGSSQTEMKPKQNCVNSSN 1708 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 104 DMMSRRTAYCLIRFGSAGKVRISV 33 D ++RR YC + FG +V I + Sbjct: 427 DEVARRDPYCYLPFGEGPRVCIGM 450 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,475 Number of Sequences: 2352 Number of extensions: 16602 Number of successful extensions: 78 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -