BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0099 (645 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom... 28 1.3 SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom... 28 1.3 SPAC13C5.04 |||glutamine amidotransferase |Schizosaccharomyces p... 27 3.1 SPBC25D12.03c |mcm7||MCM complex subunit Mcm7|Schizosaccharomyce... 25 7.1 SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 7.1 SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomy... 25 7.1 SPCC645.02 |||conserved protein |Schizosaccharomyces pombe|chr 3... 25 9.3 >SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 1887 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 347 AIFYLKKKKDISYLHNTLKLIQMQGHTAV 261 AI + + KKD+ Y+H L + HT V Sbjct: 1418 AIIFCRTKKDVEYIHRRLHQSDLFAHTHV 1446 >SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 347 AIFYLKKKKDISYLHNTLKLIQMQGHTAV 261 AI + + KKD+ Y+H L + HT V Sbjct: 1418 AIIFCRTKKDVEYIHRRLHQSDLFAHTHV 1446 >SPAC13C5.04 |||glutamine amidotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 248 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 281 MQGHTAVFLLDTPMLDIDSYIGDH 210 M H A+ DTPM++I S GD+ Sbjct: 1 MDYHIAILNADTPMVEITSAYGDY 24 >SPBC25D12.03c |mcm7||MCM complex subunit Mcm7|Schizosaccharomyces pombe|chr 2|||Manual Length = 760 Score = 25.4 bits (53), Expect = 7.1 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -2 Query: 338 YLKKKKDISYLHN-TLKLIQMQGHTAVFL-LDTPMLDIDSYIGDHITVL*RHS 186 Y + ++ +HN L + +FL LDTP + D ++ H+T + H+ Sbjct: 514 YGRYNPKVAPIHNINLPAALLSRFDILFLILDTPSRETDEHLAQHVTYVHMHN 566 >SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 275 PAFELTLTCCVGKKYLFFFLNKKSREFVNFYQDSNVVL 388 P F L + C YL+F + +S+E +++Y S +++ Sbjct: 491 PEFGLFVNCEESSNYLWFNYSHRSKE-IDYYHMSGILM 527 >SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 541 Score = 25.4 bits (53), Expect = 7.1 Identities = 7/30 (23%), Positives = 17/30 (56%) Frame = -1 Query: 321 RYFLPTQHVKVNSNAGTHCGVFVGHTNVRH 232 +Y +P + + V ++ T CG ++ ++H Sbjct: 183 QYMIPFRDINVATSCRTFCGYYISDDAIKH 212 >SPCC645.02 |||conserved protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 188 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 338 KKSREFVNFYQDSNVVL 388 KK REF N Y + NV+L Sbjct: 76 KKIREFQNIYGEKNVIL 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,376,839 Number of Sequences: 5004 Number of extensions: 45139 Number of successful extensions: 82 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -