BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0085 (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) 85 5e-17 SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 5e-17 SB_38307| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=1.6e-27) 43 3e-04 SB_235| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=3.9e-15) 38 0.012 SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) 28 7.6 >SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) Length = 172 Score = 85.4 bits (202), Expect = 5e-17 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 532 EEGALVVIAHDVDPIELVLFLPALCRKMGVPYCIVKGKSRLGALVHRKN 678 ++ LVVIAHDVDPIE+V++LPALCRKM VPYCIVKGK+RLG +VH+KN Sbjct: 59 KKAQLVVIAHDVDPIEIVVWLPALCRKMQVPYCIVKGKARLGKVVHKKN 107 >SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 85.4 bits (202), Expect = 5e-17 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 532 EEGALVVIAHDVDPIELVLFLPALCRKMGVPYCIVKGKSRLGALVHRKN 678 ++ LVVIAHDVDPIE+V++LPALCRKM VPYCIVKGK+RLG +VH+KN Sbjct: 150 KKAQLVVIAHDVDPIEIVVWLPALCRKMQVPYCIVKGKARLGKVVHKKN 198 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/56 (58%), Positives = 45/56 (80%) Frame = +3 Query: 237 LVQICKWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPET 404 L + +WP+Y+++QRQK++L +RLKVPP INQFTQ LD+ + LFK+L KYRPET Sbjct: 51 LSRFVRWPRYVKLQRQKSLLYQRLKVPPAINQFTQALDRQSTVQLFKLLHKYRPET 106 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 172 NPLFEKRPKNFAIGQGIQPTRDLSRFVSGP 261 NPL EKRP+NF IG IQP RDLSRFV P Sbjct: 29 NPLIEKRPRNFGIGGDIQPKRDLSRFVRWP 58 >SB_38307| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=1.6e-27) Length = 187 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +1 Query: 547 VVIAHDVDPIELVLFLPALCRKMGVPYCIVKGKSRLG 657 +V+A D +P+E++L LP LC VPY V+ K+ LG Sbjct: 113 IVMAADTEPLEILLHLPLLCEDKNVPYVFVRSKAALG 149 >SB_235| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=3.9e-15) Length = 544 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 517 QAGREEEGALVVIAHDVDPIELVLFLPALCRKMGVPYCIVKGK 645 +A R+ E V++A DV PI+++ +P +C +PY V K Sbjct: 108 KALRKGEKGFVILAGDVSPIDVISHIPVMCEDSKIPYAYVPSK 150 >SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) Length = 212 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 482 PLWWRLIFLGNLSFSSFPQPLFPG 411 P WW ++F+G + FS L+PG Sbjct: 56 PKWWFMLFIGTIVFSIGYLVLYPG 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,553,035 Number of Sequences: 59808 Number of extensions: 437126 Number of successful extensions: 1026 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1025 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -