BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--0016
(532 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.9
>AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface
protein chaoptin protein.
Length = 782
Score = 20.6 bits (41), Expect = 8.9
Identities = 12/62 (19%), Positives = 26/62 (41%)
Frame = +1
Query: 322 EQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLLQRREMFCSD 501
E+ + + + N+F +++H + ++R F+G I + L + F S
Sbjct: 45 EELDLSNNRLRNVPDNSFHFLRSLKKVHLQDNTIEMIHRGTFQGDIHRDLTEVYFSFNSV 104
Query: 502 EN 507
N
Sbjct: 105 RN 106
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,914
Number of Sequences: 336
Number of extensions: 3024
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12887571
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -