BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0139 (722 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 31 1.2 SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) 28 6.7 SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) 28 8.8 SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +2 Query: 83 SXITAVVTSQCTKNNAEDKV-PEVEAXLRTFGNCLKGLVDLNVLKTEIEEAKPNGALDEV 259 S + + CT++N D++ E A + + L + K ++A P G LD+ Sbjct: 319 SGAARLADADCTRDNTRDRIIAECNAVRQALQDLLSEYMSHAGGK---KKAVPGGPLDKA 375 Query: 260 FKKYCDKSAQLKG 298 +K C K++ L+G Sbjct: 376 IEKMCSKTSGLRG 388 >SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) Length = 1243 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 249 SAPFGLASSISVFRTFKSTSPLRQFP 172 S PFG+ S+ S+ + F S + L++FP Sbjct: 458 SLPFGIQSASSLVKLFLSNNKLKEFP 483 >SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) Length = 601 Score = 27.9 bits (59), Expect = 8.8 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 62 GVXADDFSXITAVVTSQCTKNNAEDKVPEVEAXLRTFGNCLKGLVDLNV-LKTEIEE 229 G+ D +S I +V N A D + EVE R L D N LKT + E Sbjct: 299 GIGVDLYSIINTLVECDKKSNQAADAIKEVEKAEREVSKSETELRDFNTELKTFMRE 355 >SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 173 GNCLKGLVDLNVLKTEIEE 229 GNCLKG+V++NV IE+ Sbjct: 277 GNCLKGIVNVNVSPNIIEQ 295 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,739,804 Number of Sequences: 59808 Number of extensions: 349530 Number of successful extensions: 773 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -