BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0375 (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12829| Best HMM Match : zf-CCHC (HMM E-Value=6e-06) 28 4.6 SB_2338| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_12829| Best HMM Match : zf-CCHC (HMM E-Value=6e-06) Length = 159 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 457 PAQAIXIEAQERXDGSRXPLYXIFDXTKCLYCG 555 P Q+ + R DG P +F +KC CG Sbjct: 110 PPQSATVSKCYRCDGKHDPRSCVFSQSKCFSCG 142 >SB_2338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 457 PAQAIXIEAQERXDGSRXPLYXIFDXTKCLYCG 555 P Q+ + R DG P +F +KC CG Sbjct: 1240 PPQSATVSKCYRCDGKHDPRSCVFSQSKCFSCG 1272 >SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 980 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 137 HSTAHHQKEMLRRFTHRTYLDINM*MQRNKTCLSGLCQI--GSSDNVL 274 H+T H + R TH T +N+ + N L LC+I G+ NV+ Sbjct: 188 HATTHKTLPHIPRHTHITQALVNIQVNSNNGTLPLLCKIDTGAEGNVI 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,036,110 Number of Sequences: 59808 Number of extensions: 297155 Number of successful extensions: 483 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -