BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0338 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50380.1 68416.m05511 expressed protein 32 0.39 At5g43090.1 68418.m05260 pumilio/Puf RNA-binding domain-containi... 28 6.3 >At3g50380.1 68416.m05511 expressed protein Length = 3071 Score = 31.9 bits (69), Expect = 0.39 Identities = 19/49 (38%), Positives = 22/49 (44%) Frame = +2 Query: 110 IHTISTSYTSAISVSLRIIACCLEVDTF*ICSLYKILAPYLYTSCIKLK 256 I + TS S V I+ CL VD F + L YL SC KLK Sbjct: 487 ISSFMTSKDSTGHVDSNIVMLCLSVDEFLVLYTVGCLTQYLSASCGKLK 535 >At5g43090.1 68418.m05260 pumilio/Puf RNA-binding domain-containing protein contains similarity to RNA-binding protein Length = 527 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 166 YNSKTHRYSASVGSGNGM-NIAVLNRVKCVS 77 Y ++++RY ++G GNGM N + LN V C S Sbjct: 140 YVNQSYRYD-TIGGGNGMLNNSFLNGVPCAS 169 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,745,819 Number of Sequences: 28952 Number of extensions: 247160 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -