Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0287
         (657 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL023847-2|CAA19546.1|  359|Caenorhabditis elegans Hypothetical ...    28   5.1  

>AL023847-2|CAA19546.1|  359|Caenorhabditis elegans Hypothetical
           protein Y57A10C.4 protein.
          Length = 359

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = +2

Query: 305 LPTMNHSWPL--KIGLINYHYIKNYYSKWFHYNRTPH 409
           L  +N SW L   IG I Y+YI+   +KW    + P+
Sbjct: 194 LYVLNASWILCILIGTIMYYYIRKINTKWLQEMQNPN 230


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,475,063
Number of Sequences: 27780
Number of extensions: 255564
Number of successful extensions: 517
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 510
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 517
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1465835342
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)