SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0229
         (666 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    23   3.5  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   6.0  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   6.0  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   6.0  

>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = +2

Query: 467 HILXAMSEYXQVXHRMKHEPYAGELKXSTYLXNNGSPTHSS 589
           H+    SE+  +  R+   PY    +  T L NN  P +SS
Sbjct: 66  HLKWNASEFAGI--RVIRVPYNRVWRPDTILYNNADPQYSS 104


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = -2

Query: 233 ERPKHS*TPESAQSLFIAARSSSLNGS 153
           E  ++S  P+S   L +++R S +NG+
Sbjct: 232 ESHQNSNVPKSVAGLNVSSRRSDMNGT 258


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 256 PLNISWTTSTG 288
           PLNI W+T+ G
Sbjct: 59  PLNIDWSTADG 69


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 256 PLNISWTTSTG 288
           PLNI W+T+ G
Sbjct: 59  PLNIDWSTADG 69


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,052
Number of Sequences: 438
Number of extensions: 3530
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20099475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -