BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0203 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 52 3e-07 SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) 49 3e-06 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 48 7e-06 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 7e-06 SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 45 6e-05 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 45 6e-05 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 42 3e-04 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 42 3e-04 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 42 6e-04 SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) 41 8e-04 SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) 41 8e-04 SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) 40 0.001 SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) 40 0.001 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 40 0.002 SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) 40 0.002 SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 39 0.003 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 39 0.003 SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) 39 0.004 SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) 38 0.006 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 38 0.007 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 38 0.007 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 36 0.022 SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) 36 0.029 SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) 36 0.029 SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 36 0.039 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) 35 0.051 SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) 35 0.051 SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 32 0.36 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.39 SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_52003| Best HMM Match : BTB (HMM E-Value=1e-16) 31 0.63 SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) 31 0.84 SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) 30 1.5 SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) 29 2.6 SB_56853| Best HMM Match : BTB (HMM E-Value=1.1e-16) 29 3.4 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_46033| Best HMM Match : Phage_integrase (HMM E-Value=0.022) 29 4.5 SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) 29 4.5 SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) 28 7.8 SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 52.4 bits (120), Expect = 3e-07 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 2/72 (2%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEEL 450 + AH++VLS CS YF MF N ++ ++++K + +AL+ L+ F Y G+ QE + Sbjct: 43 ISAHRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDETALQLLVDFAYTGKAEITQENV 102 Query: 451 ASFISTAEQLQV 486 + A LQ+ Sbjct: 103 QLLLPAANMLQL 114 >SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) Length = 635 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L EG AH+LVL+ SP+F +F +M Q + LK V S + ++L+++Y G+ Sbjct: 38 LMVEGLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIVLKQVKASVMENVLEYLYTGKT 97 Query: 430 NXKQEELASFISTAEQLQVKG 492 + E + +A ++G Sbjct: 98 SLNPENAEDLVVSASYFLIEG 118 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 2/78 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 + +G+ + AHKLVLS S YF+ MF M +Q + ++ + ++ L++F Y V Sbjct: 31 MTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLVEFAYTSNV 90 Query: 430 NXKQEELASFISTAEQLQ 483 E + + + A LQ Sbjct: 91 RINSENVETLLYAASMLQ 108 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 2/72 (2%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEEL 450 + AH++VL+ CSPYF+ MF +M ++ + ++DV SA+ L+ F Y + ++ + Sbjct: 70 IHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITFAYTASITIEETNV 129 Query: 451 ASFISTAEQLQV 486 + + A LQ+ Sbjct: 130 QTLLPAACLLQL 141 >SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEEL 450 + AH++VL+ SPYF MF +++ ++ +V LK++ AL L++F+Y E+ ++ + Sbjct: 52 IPAHRVVLASSSPYFFAMFTGELSESRQTVVTLKEIDSLALELLIEFVYIAEIEVTEDNV 111 Query: 451 ASFISTAEQLQV 486 + A LQ+ Sbjct: 112 QVLLPAANLLQL 123 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 2/80 (2%) Frame = +1 Query: 253 KLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGE 426 K+ + ++AHKLVL+ S YF MF M T V L D+ +A++ L+ + Y E Sbjct: 37 KIVIGDKRIRAHKLVLASFSDYFSAMFTGDMAETSQNTVHLTDMDPAAVQALISYSYTSE 96 Query: 427 VNXKQEELASFISTAEQLQV 486 + + + + + +S A LQ+ Sbjct: 97 IEIRVDNVENLLSVACILQI 116 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = +1 Query: 286 HKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEELASF 459 H+ VL+ CS YF MF ++ ++ I+ +KD+ ++ L++F Y G V E + + Sbjct: 26 HRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFAYTGRVEITVENVQNL 85 Query: 460 ISTAEQLQ 483 ++TA LQ Sbjct: 86 LATASLLQ 93 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQFMYQGE 426 L + + +HKLVL+ SPYF+ MF N TQ I L D+ AL+ ++++ Y G+ Sbjct: 37 LCVDDEEIPSHKLVLAASSPYFRAMFTSNLLECTQRTIT-LYDIDVGALQQIVEYFYTGK 95 Query: 427 VNXKQEELASFISTAEQLQV 486 + ++ + + + LQV Sbjct: 96 ITIDEDNVQFLLHASCLLQV 115 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 2/79 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L E + HK+V+S SPYF+ +F + + V ++ + LL F+Y G + Sbjct: 38 LKVEEKQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFSALLDFIYTGVI 97 Query: 430 NXKQEELASFISTAEQLQV 486 N +E + + A+ LQ+ Sbjct: 98 NVNEENVQQLLPAAKMLQL 116 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 44.8 bits (101), Expect = 6e-05 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 2/85 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L EG+ AH++VL+ S YF +F +M P V L+++ S + +L ++Y GE+ Sbjct: 34 LVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYLYTGEI 93 Query: 430 NXKQEELASFISTAEQLQVKG*PGI 504 + I++A L + GI Sbjct: 94 TVTELNAEDLIASANYLLIPRLKGI 118 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 44.4 bits (100), Expect = 8e-05 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L EGR H+ VL+ SP+F MF M + + L+ + A+ +L+F Y E+ Sbjct: 60 LQVEGRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQSIKAKAMESILEFFYTQEI 119 Query: 430 NXKQEELASFISTAEQL 480 +++EL + A L Sbjct: 120 VLEEDELLDLLDAASFL 136 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 44.4 bits (100), Expect = 8e-05 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = +1 Query: 271 RLLQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEE 447 R + AHK VLS+ S F MF TQ V L DV SA LL+F+Y EV E Sbjct: 1622 RRIPAHKFVLSIGSAVFDAMFNGGIATQSDEVELPDVEPSAFMALLRFLYTDEVQIGPET 1681 Query: 448 LASFISTAEQLQV 486 + + + TA++ + Sbjct: 1682 VMTTLYTAKKYAI 1694 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 2/75 (2%) Frame = +1 Query: 271 RLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQE 444 R + AH+LVL+ CS YF MF ++ ++ + L+ + A+ L++F Y + ++ Sbjct: 51 RRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEFAYTARIQVSED 110 Query: 445 ELASFISTAEQLQVK 489 + + + A LQ++ Sbjct: 111 NVQALLPAASLLQLE 125 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 2/75 (2%) Frame = +1 Query: 271 RLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQE 444 R + AH+LVL+ CS YF MF ++ ++ + L+ + A+ L++F Y + ++ Sbjct: 51 RRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEFAYTARIQVSED 110 Query: 445 ELASFISTAEQLQVK 489 + + + A LQ++ Sbjct: 111 NVQALLPAASLLQLE 125 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 2/79 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 + A R ++ H++VL+ CS YF MF M + ++ ++ +S ++ L+ FMY ++ Sbjct: 38 IKAGERKIRCHRVVLASCSAYFHSMFTNSMLESSQEVITIQGLSEKSVIQLINFMYTRKI 97 Query: 430 NXKQEELASFISTAEQLQV 486 + + S ++ + Q+ Sbjct: 98 TITIDNIESLLTASAVFQL 116 >SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 548 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQFMYQGE 426 + G+ AH+ VL+ SPYF+ MF + + V L++++ + +LL F+Y G Sbjct: 54 IVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVILENITADVMEELLNFIYAGT 113 Query: 427 VNXKQEELASFISTAEQL 480 + + +S + L Sbjct: 114 IKITPFNVKDLVSASNYL 131 >SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 570 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQFMYQGE 426 + G+ AH+ VL+ SPYF+ MF + + V L++++ + +LL F+Y G Sbjct: 54 IVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVILENITADVMEELLNFIYAGT 113 Query: 427 VNXKQEELASFISTAEQL 480 + + +S + L Sbjct: 114 IKITPFNVKDLVSASNYL 131 >SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 595 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGEVN 432 L +G AHK +L+ S YF MF + T V +++++ +A+ LL F+YQG++ Sbjct: 38 LIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRTVVVQEITSTAMEVLLAFIYQGKLL 97 Query: 433 XKQEEL 450 +E + Sbjct: 98 ITEENV 103 >SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) Length = 603 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L EG++ AH+ VL+ S +F MF M + + L ++ AL +L F Y E+ Sbjct: 56 LEVEGQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSILDFFYTREI 115 Query: 430 NXKQEELASFISTAEQL 480 N ++ + + A L Sbjct: 116 NISRDNVVDILEAASFL 132 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Frame = +1 Query: 271 RLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQE 444 R + AH+LVL+ S YFQ MF + + V L+DV A+ L+ F Y G+++ E Sbjct: 56 RQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVTLRDVDSGAVELLVDFAYTGKLDITTE 115 Query: 445 ELASFISTAEQLQV 486 + S + + Q+ Sbjct: 116 NVQSIMYASSLFQL 129 >SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) Length = 398 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 2/80 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L A GR +AHK +L+ SP F MF +M ++ V + D+ +++L+F+Y G Sbjct: 227 LIAGGREFKAHKAILAARSPVFSAMFEHEMEESRKGRVEILDIDPDVFQEMLKFVYTGNT 286 Query: 430 NXKQEELASFISTAEQLQVK 489 Q ++ A++ ++ Sbjct: 287 PQIQGMADDLLAAADKYDLE 306 >SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEEL 450 + +H+L+L+ S YF MF M+ T + LK+V + +R L+++ Y + + + Sbjct: 47 IPSHRLILAANSSYFYSMFTSGMSETAQNRINLKEVDATVVRQLIEYCYTSTIEINENNV 106 Query: 451 ASFISTAEQLQ 483 + +S LQ Sbjct: 107 QNLLSIGNLLQ 117 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 2/79 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L +G ++AH++VL+ CSPYF+ M T + L + ++ ++++ Y + Sbjct: 43 LHVQGEEIKAHRVVLAACSPYFRAMLTTGFAETFMSTIPLHECDPVGVQSIVEYFYSKRL 102 Query: 430 NXKQEELASFISTAEQLQV 486 +E + +S A ++ Sbjct: 103 TITKENIEGLLSAASLFEI 121 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 + AE AH+ +LS S YF MF M + +V + V+ ++R +L F+Y GE+ Sbjct: 38 IKAEDTEFLAHRNILSASSDYFFAMFNGNMKESSQDVVTITGVTPDSMRSILNFIYTGEI 97 >SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) Length = 467 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 283 AHKLVLSVCSPYFQEMFKMNPTQH-PIVFLKDVSHSALRDLLQFMYQGEV 429 AHK VLSV SP F+ MF N + P V L D + ++LL+++Y +V Sbjct: 45 AHKFVLSVSSPVFEAMFFGNLAESGPTVRLPDCTVDGFQELLRYLYCDQV 94 >SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +1 Query: 274 LLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEE 447 L AH+ +L+ SPYF+ +F +M Q + L +V + D+L ++Y G V ++ + Sbjct: 36 LFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYLYSGSVVVEESK 95 Query: 448 LASFISTAEQL 480 A+ + Sbjct: 96 AIPLTVAADYM 106 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L E AHK +L+ S YF MF M + V LK + S ++++L F+Y G + Sbjct: 45 LLVENEEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEILDFLYTGRI 104 Query: 430 NXKQEELASFISTAEQL 480 + + + + L Sbjct: 105 EIDNKNVRDLLEASSFL 121 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 274 LLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 L AH+ +L+ SPYF+ +F +M Q + L +V + D+L ++Y G V Sbjct: 1405 LFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYLYSGSV 1458 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 36.3 bits (80), Expect = 0.022 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMY 417 L E + AH++VL+ CS YF MF M +Q ++ L+ ++ + LL F+Y Sbjct: 42 LQVEKKEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQGLASDTMEVLLDFVY 97 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 36.3 bits (80), Expect = 0.022 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRDLLQFMYQGEVNXKQEELA 453 + AH+ VL+V SP F+ MF + V L D + AL ++L++ Y EV + Sbjct: 461 IPAHRYVLAVSSPVFEAMFHGAMAESSRKVSLPDCTAEALSEMLRYAYFDEVELTGSNVM 520 Query: 454 SFISTAEQLQVKG 492 S + AE+ + G Sbjct: 521 SVMYLAEKYILPG 533 >SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 35.9 bits (79), Expect = 0.029 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +1 Query: 283 AHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEELAS 456 AHK VL S +F +F M Q V LK + + DLL ++Y G++ + Sbjct: 34 AHKNVLCASSIFFNGLFSSSMRERQENTVNLKQFPVNIMEDLLTYLYTGKLEVTEATAQD 93 Query: 457 FISTAEQL 480 F++ A+ L Sbjct: 94 FLAAADFL 101 >SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) Length = 417 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +1 Query: 259 AAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRDLLQFMYQGEVNX 435 A E + AH+ VLSV SP F+ MF + + L D AL ++L++ Y EV Sbjct: 37 AGEKISIPAHRYVLSVSSPVFEAMFHGAMAESSREISLPDCYAEALSEMLRYAYYDEVKL 96 Query: 436 KQEELASFISTAEQLQVKG 492 + + AE+ G Sbjct: 97 TGSNAMAVMYLAEKYNFPG 115 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 35.5 bits (78), Expect = 0.039 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 6/77 (7%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMYQG- 423 L A +L AH++VL+ SPYF+E+ + V + A+ +L+F Y G Sbjct: 45 LKAGNLVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVMPDSLKPGAVVAMLEFFYSGT 104 Query: 424 -EVNXKQ-EELASFIST 468 ++N K E+L + ST Sbjct: 105 LQINLKSIEDLLAAAST 121 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 35.5 bits (78), Expect = 0.039 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +1 Query: 274 LLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLK-DVSHSALRDLLQFMYQGEVNXKQEEL 450 + AHK+VL+ S YF+ +F + + D+S L+ +L+++Y G+V+ Sbjct: 40 IFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLDISTRTLKAILKYVYCGDVSLNVSNA 99 Query: 451 ASFISTAEQLQV 486 S A+ L + Sbjct: 100 RSVFVAADYLMM 111 >SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) Length = 259 Score = 35.1 bits (77), Expect = 0.051 Identities = 20/88 (22%), Positives = 39/88 (44%) Frame = +1 Query: 226 AVAWRSRRRKLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLL 405 +V W L E + HK LS+ SP F++MF+ Q + L ++++L Sbjct: 11 SVPWHLSDAVLVVEEKHFNVHKSTLSMWSPVFEKMFRERNDQE--ICLPGKKSKEIKEML 68 Query: 406 QFMYQGEVNXKQEELASFISTAEQLQVK 489 +Y +E ++ A++ Q++ Sbjct: 69 LVIYPTSKKVTEENCYYLLTLAQEYQME 96 >SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) Length = 133 Score = 35.1 bits (77), Expect = 0.051 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 + AHK VL+ SP F+ MF K+ T I L D + + ++L+++Y+ EV Sbjct: 10 IPAHKYVLATSSPVFEAMFFGKLAETSRNIT-LPDCFYEGVLEMLRYLYRDEV 61 >SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 34.7 bits (76), Expect = 0.068 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 429 + AHK VL+ SP F+ MF K+ T I L D S + ++L+F+Y E+ Sbjct: 41 IPAHKYVLATSSPVFEAMFFGKLAETGFTIA-LPDCSAEGMLEMLRFIYTEEI 92 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 34.3 bits (75), Expect = 0.090 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +1 Query: 268 GRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQ 441 G+ HK VL SP+F+ +F M + L+ +S +++ FMY G + ++ Sbjct: 43 GKTHPVHKNVLCAASPFFRGLFTNDMQEKNQEHIELQVISGDVGEEVISFMYTGAIKVEK 102 Query: 442 EELASFISTAEQLQV 486 E + + L + Sbjct: 103 ENAQDIVMAGDFLLI 117 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEELA 453 + HKL+L++ SP F MF + Q + + D + +LL++ Y E +E + Sbjct: 2776 IPGHKLILAISSPVFYAMFYGSMAEQKAEITVADSDADSFMELLRYAYFDEATINEENVL 2835 Query: 454 SFISTAEQ 477 + A++ Sbjct: 2836 GVLYLAKK 2843 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 27.9 bits (59), Expect(2) = 0.39 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMF----KMN--PTQHPIVFLKDVSHS 387 L AH+ +LS SP F+E+F K+N P ++ +F D+S S Sbjct: 263 LHAHQTILSAASPIFRELFLGSKKVNAVPRKYQAIF-SDISWS 304 Score = 23.0 bits (47), Expect(2) = 0.39 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 373 DVSHSALRDLLQFMYQGEVNXKQEELASFISTAEQLQVK 489 D+S + +LQF+Y G + E + F+ ++ K Sbjct: 329 DISCESFEKILQFLYTGLPGFSEIEDSDFVLDVKKTAAK 367 >SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 31.5 bits (68), Expect = 0.63 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVF-----LKDVSHSALRDLLQFMYQ 420 L G A+K +LS YF++MF + + P+ + ++++S LLQ++Y Sbjct: 116 LLYSGSRFHANKAILSARCSYFKDMFS-DESNQPLTYSVDIPVEEISTGMFASLLQYLYT 174 Query: 421 GE 426 G+ Sbjct: 175 GD 176 >SB_52003| Best HMM Match : BTB (HMM E-Value=1e-16) Length = 501 Score = 31.5 bits (68), Expect = 0.63 Identities = 17/82 (20%), Positives = 39/82 (47%), Gaps = 9/82 (10%) Frame = +1 Query: 274 LLQAHKLVLSVCSPYFQ---------EMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGE 426 ++ AH+ L+V SP F+ E K+ + ++ + + + ++L+++Y GE Sbjct: 100 IIPAHRYALAVGSPVFKTNFEDRWSAEKLKLTDSSKLLIPIANYTAEGFSEMLRYVYYGE 159 Query: 427 VNXKQEELASFISTAEQLQVKG 492 V + + + +EQ + G Sbjct: 160 VELSESNVMEIMYLSEQYDLPG 181 >SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) Length = 176 Score = 31.1 bits (67), Expect = 0.84 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Frame = +1 Query: 286 HKLVLSVCSPYFQEMFK---MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEELAS 456 HKLVL+ S YF+ MF + +++ +V L D+ + ++ + Y ++ + + Sbjct: 47 HKLVLAANSTYFRAMFGEGFVESSKNDVV-LHDLDPKGVNAVISYFYNSKIEINADNFGA 105 Query: 457 FISTAEQLQVK 489 + A VK Sbjct: 106 VFAVANMWDVK 116 >SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) Length = 619 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/72 (23%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Frame = +1 Query: 286 HKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEELA 453 HKLVL+ S YF+ MF + + V L D+ + ++ + Y ++ + Sbjct: 89 HKLVLAANSTYFRAMFGLREGFVESSKNDVVLHDLDPKGVNAVISYFYNSKIEINADNFE 148 Query: 454 SFISTAEQLQVK 489 + + A VK Sbjct: 149 AVFAVANMWDVK 160 >SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) Length = 239 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = +1 Query: 256 LAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNX 435 L E + HK +L + SP F+ MF+ PI L + + DL+ +Y N Sbjct: 22 LVVEEQEFHVHKFILKMASPVFKAMFEHVKDSKPIQ-LPGKKFNQVLDLMNHIYPTSNNS 80 Query: 436 K--QEELASFISTAEQLQVK 489 + + + A + Q+K Sbjct: 81 SITMDNVEHLSALAAEYQIK 100 >SB_56853| Best HMM Match : BTB (HMM E-Value=1.1e-16) Length = 605 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +1 Query: 277 LQAHKLVLSVCSPYFQEMF-KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQE 444 + AHK +L V SP F MF T V L D L + L+++Y V E Sbjct: 47 IPAHKYILGVSSPVFFAMFYGQMSTSISKVELPDCDSVGLIEFLRYLYCNRVKFTME 103 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +1 Query: 253 KLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQ 420 KL+ + R+ Q + +C+P F ++ M+P + + L ++ D ++F YQ Sbjct: 520 KLSCKSRIFQCSRGAGVICTPPFFDLNIMSPMRVNLEVLSTSKNAKCSDPVEFTYQ 575 >SB_46033| Best HMM Match : Phage_integrase (HMM E-Value=0.022) Length = 645 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -2 Query: 296 TNLCACNNLPSAANLRL---RDLHATAGHESPLTYLRGNCSSIVKIVR 162 T+L A PS+ + L R LH +GH PL+ NC + +IVR Sbjct: 382 THLAASIRYPSSIKVYLSAVRSLHIESGHADPLS----NCERLQRIVR 425 >SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) Length = 604 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 274 LLQAHKLVLSVCSPYFQEMFKMNPTQH 354 LLQAH+ VLS+ S +F++ F+ H Sbjct: 322 LLQAHRFVLSIGSEWFRDFFENQDHLH 348 >SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/57 (24%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +1 Query: 271 RLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSH---SALRDLLQFMYQGEVN 432 R + HK+VL+ SPYF+ +F + + + ++ S+ A+ +++ ++Y G+++ Sbjct: 57 RRIPCHKVVLAARSPYFRHLFINSESGQYVKNVELPSYFSILAVDEVINYLYSGKLH 113 >SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 628 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/51 (21%), Positives = 28/51 (54%) Frame = +1 Query: 337 MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEELASFISTAEQLQVK 489 M+ ++ V L+++ A+++++ F Y G++ + + + A LQV+ Sbjct: 66 MSESRQDTVTLQELDEKAMQNMIDFFYSGKIEISELNVQEVLPIACLLQVQ 116 >SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 152 MASDEQFSLCWNNFHANMSAGFHGL 226 M S E WN F N++AG+H L Sbjct: 203 MMSYEGMQFDWNTFSVNLTAGYHQL 227 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,203,486 Number of Sequences: 59808 Number of extensions: 343029 Number of successful extensions: 867 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 856 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -