BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e17 (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 25 0.47 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 7.6 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 25.4 bits (53), Expect = 0.47 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +3 Query: 453 PVINDDGPSTEKTKGDYCPASERCLEYPTSNFDTMIHLLKGNIGTGILAMPDA 611 PV N D ++E + Y P + C + D + L +G + T +L D+ Sbjct: 45 PVSNSDSENSEVSSNSYTPKIKSCRPFKAYIKDPLT-LAQGLVSTEMLLKKDS 96 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 556 IVSKFDVGYSKHLSDAGQ 503 +VSKF G+S+ S+ G+ Sbjct: 106 VVSKFRAGFSECASEVGR 123 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,629 Number of Sequences: 336 Number of extensions: 3048 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -