BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e13 (492 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) 66 1e-11 SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 5e-11 SB_15653| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.055 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) 27 6.4 >SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) Length = 327 Score = 66.5 bits (155), Expect = 1e-11 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 5/77 (6%) Frame = +1 Query: 196 AKLRKWLNMKFRIEMTDGRVLIGVFLCTDRDANVILGACSEYLK-----NNEGETEEPRV 360 +K+ +N + R + DGRV IG FL D+ NVILG C E+ K + E EE RV Sbjct: 30 SKMLLHINYRMRCTLQDGRVFIGTFLAFDKHMNVILGDCDEFRKIKGKSSKAQEREEKRV 89 Query: 361 LGLVMVPGRHIVSIQID 411 LGLV++ G H+VS+ +D Sbjct: 90 LGLVLLRGEHLVSMTVD 106 >SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 64.5 bits (150), Expect = 5e-11 Identities = 27/55 (49%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 169 PQVVEEEG---KAKLRKWLNMKFRIEMTDGRVLIGVFLCTDRDANVILGACSEYL 324 P V+E E + +L WLN R++++DGR LIG FLCTD+D N+ILG+C E++ Sbjct: 19 PSVIENEKSEQRKELESWLNKLMRVKISDGRTLIGSFLCTDKDRNIILGSCQEFV 73 >SB_15653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 34.3 bits (75), Expect = 0.055 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = -2 Query: 251 LPSVISILNFIFNHFLSFAFPSSSTT*GASEVVLLPSLLISLA-CSNLYP*TINEFLAKV 75 L S+ S++ + FP S +L +L+ +LA C +YP + F K Sbjct: 59 LASLFSLVGIAVERTYAVFFPFKHRLSKTSSYLLWITLVETLAFCRGIYPLYLF-FNGKT 117 Query: 74 WKYFYTALFCSQVHGYTIEV 15 KY+ + CS V GYT+ + Sbjct: 118 VKYYTMYMICSDVSGYTVSL 137 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 130 EMSNEGNKTTSEAPQVVEEEGKAKLRKWLNMKFRIEMTDGRV 255 EMS EGN T S +EE ++ +W K I++ DG V Sbjct: 1115 EMSQEGNSTVSSVATGSDEE-RSSESQWQIPKIVIQLPDGEV 1155 >SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) Length = 816 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 175 VVEEEGKAKLRKWLNMKFRIEM-TDGRVLIGVFLCTDRDANVILGACSE 318 V E + K+ + ++ K ++ + T G +L+GV R A +L CSE Sbjct: 281 VFETDIKSSVESIVSPKMKMALRTSGHLLLGVVRIYSRKAKYLLADCSE 329 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,189,075 Number of Sequences: 59808 Number of extensions: 236198 Number of successful extensions: 486 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -