BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d22 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 28 0.31 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 25 2.2 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 24 5.0 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.8 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 23 8.8 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 27.9 bits (59), Expect = 0.31 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 469 CWCGCNISSTTES*SYTFRILWKCRSRSGRC 561 C CG + TE YT R KC + +GRC Sbjct: 651 CECGTCRCTVTEDGRYTGRYCEKCPTCAGRC 681 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 578 QFEEYKSTLGKKILPKSQIYLHDDCDID 661 +F + ++ LG +L KS + +DCD+D Sbjct: 445 RFGKLQTCLGLAMLLKSYTFSLEDCDVD 472 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 348 LDSPNFGMGDNFNIFQSLPPDS 283 L +P+F + DNF F+S P S Sbjct: 290 LATPDFNLFDNFKKFRSSHPQS 311 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 365 DPTFAFVAVSGLGSECLTYNVSEQLDENKEAIRI 466 DP F AV S+C +++S Q KE +R+ Sbjct: 1013 DPMFRMSAVFNTVSDCFDFDISTQC--FKERLRL 1044 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -1 Query: 417 VKHSDPRPDTATNANVGSKSKNILDSPNFGMG 322 VK P P A+ N G NI +P G G Sbjct: 175 VKQYRPDPAKASAPNAGKSLSNIQPTPPKGAG 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,683 Number of Sequences: 2352 Number of extensions: 16450 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -