BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0128 (393 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 36 2e-04 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 26 0.18 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 1.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 3.8 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 3.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 5.1 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 35.9 bits (79), Expect = 2e-04 Identities = 16/60 (26%), Positives = 31/60 (51%) Frame = -1 Query: 276 QFENLFNGNKVLATPVEEFVNSNWKDVMQEVAPPIVRSIVSEVVAAVNALYKAVPAEELY 97 +FENLF+GNK L + F+N N + + +E+ + N ++ VP ++++ Sbjct: 191 RFENLFDGNKELGEQMNRFINENSELLFKELQAAYEETFSLVFTKIDNEIFNRVPFDKIF 250 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.8 bits (54), Expect = 0.18 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 128 CTRLCRPKNFTCSKLIVILKGKAVYVI 48 CT++ NFTC +++ +LK + Y + Sbjct: 222 CTQVYSTGNFTCLEVVFVLKRRLGYYL 248 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 376 ATDLVTVTGADGKATLAYRVVEAHVRSED 290 ++D V ++ KAT A + H+R+ED Sbjct: 434 SSDSVLLSPEASKATEAVEFIAEHLRNED 462 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 3.8 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 141 QPPPRTRWTGRWAG 182 +PPPR W G G Sbjct: 998 KPPPREDWNGEILG 1011 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 3.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 151 LGHDGPDDGRGYFLHHVLPV*VHKFFDG 234 L D P + GY + + HK+FDG Sbjct: 601 LCRDNPAERLGYQKGGISEIQKHKWFDG 628 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/20 (30%), Positives = 11/20 (55%) Frame = -1 Query: 351 ELTARPHWHIESWKHTYEVK 292 E R W +E W+H ++ + Sbjct: 418 ENNRRNPWFVEFWEHHFQCR 437 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,608 Number of Sequences: 438 Number of extensions: 2335 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -