SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    21   7.7  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   7.7  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   7.7  

>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 10/54 (18%), Positives = 26/54 (48%)
 Frame = -2

Query: 208 VLVQTTLKSFLFLMVPSNILYLFELKNEIPQL*NLFSHRFYFVFEAVKVYKYQN 47
           +++ T + SF   ++P  +  L+ +     Q+ +L   ++Y +    ++  Y N
Sbjct: 290 LMLGTVVLSFFLCLIPFRVFILWIILVPEEQVYHLEIEKYYNILYFCRIMVYLN 343


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +2

Query: 533  PAEPKVHWTYF 565
            P +PKV++TYF
Sbjct: 1255 PFDPKVNFTYF 1265


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +2

Query: 533  PAEPKVHWTYF 565
            P +PKV++TYF
Sbjct: 1255 PFDPKVNFTYF 1265


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,351
Number of Sequences: 336
Number of extensions: 3551
Number of successful extensions: 11
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19363530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -