SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10027_5prime_partial:A_SariMSG_c23648_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_dual_serine/threonine_and_tyrosine_protein_kinase-like_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004712 F protein serine/threonine/tyrosine kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030054 C cell junction
GO:0033674 P positive regulation of kinase activity
GO:0035556 P intracellular signal transduction
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0045743 P positive regulation of fibroblast growth factor receptor signaling pathway
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
RNA-seq EntryA_SariMSG_c23648_g1_i1
Sequence
(Amino Acid)
SGSVVGTPVHMAPELLDGDYDAAVDVYAFGILFWYVCAGNIKLPSAFEMFQNKEQLWNKV
KKGLRPERLPQFSEECWEVMESCWASEPSQRALLGDVHPKLEGILERALQDRESAHNTRT
SSGGDLSDDDSLDMTGIDKH
*(46 a.a.)

- SilkBase 1999-2023 -