SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG10047_complete:A_ErmoMG_comp35311_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106717608_[Papilio_machaon]
Ontology
GO:0000166 F nucleotide binding
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005123 F death receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0010942 P positive regulation of cell death
GO:0012501 P programmed cell death
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0031264 C death-inducing signaling complex
GO:0031625 F ubiquitin protein ligase binding
GO:0032403 F protein-containing complex binding
GO:0032757 P positive regulation of interleukin-8 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0034612 P response to tumor necrosis factor
GO:0036289 P peptidyl-serine autophosphorylation
GO:0042327 P positive regulation of phosphorylation
GO:0042802 F identical protein binding
GO:0043065 P positive regulation of apoptotic process
GO:0043068 P positive regulation of programmed cell death
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043124 P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043234 C protein-containing complex
GO:0043235 C receptor complex
GO:0043410 P positive regulation of MAPK cascade
GO:0044257 P cellular protein catabolic process
GO:0045121 C membrane raft
GO:0045651 P positive regulation of macrophage differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046330 P positive regulation of JNK cascade
GO:0046777 P protein autophosphorylation
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051260 P protein homooligomerization
GO:0051291 P protein heterooligomerization
GO:0060545 P positive regulation of necroptotic process
GO:0070231 P T cell apoptotic process
GO:0070266 P necroptotic process
GO:0070513 F death domain binding
GO:0070926 P regulation of ATP:ADP antiporter activity
GO:0071356 P cellular response to tumor necrosis factor
GO:0071363 P cellular response to growth factor stimulus
GO:0097191 P extrinsic apoptotic signaling pathway
GO:0097342 C ripoptosome
GO:0097343 P ripoptosome assembly
GO:0097527 P necroptotic signaling pathway
GO:1901026 P ripoptosome assembly involved in necroptotic process
GO:1990000 P amyloid fibril formation
GO:2000377 P regulation of reactive oxygen species metabolic process
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
GO:2001238 P positive regulation of extrinsic apoptotic signaling pathway
GO:2001240 P negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
RNA-seq EntryA_ErmoMG_comp35311_c0_seq1
Sequence
(Amino Acid)
MATLKTKLSEFIKGFRTDAVPRPPRPVNVDFNHEVPQENPADEENDSSEYEEIIIEEEDD
DIKKKPKQKKAKSFFKPKIPKQTPKKQNPNNDKNSINTQAAGNVLNVVGCKSVRWGNDYY
MGTTYIGAKGANTAKQEAYDDSDLEDEIVKTGPIKSVMKATVKPEDEHLDYISKNLGKTW
RKFFRKLGFTEGRIDTFEHDNKIYGVQEVRYKLLIEWTQKKSDATLGALAKLLWEHGEKC
VVKELADIYSEKK
*(83 a.a.)

- SilkBase 1999-2023 -