SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000006-TA|BGIBMGA000006-PA|IPR012464|Protein of unknown
function DUF1676
         (270 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    25   0.95 

>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 24.6 bits (51), Expect = 0.95
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 71  VEDDESADPRLAKDPAYEMFD--KVDKFLQSHTLRV 104
           +++DES  P+L   P +EM D  K+D  +    +RV
Sbjct: 82  LKNDESESPKLNPYPNWEMNDINKIDSIINIIRVRV 117


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.132    0.378 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 58,037
Number of Sequences: 429
Number of extensions: 1810
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 270
length of database: 140,377
effective HSP length: 57
effective length of query: 213
effective length of database: 115,924
effective search space: 24691812
effective search space used: 24691812
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -