GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002077-TA|BGIBMGA002077-PA|IPR005079|Peptidase C45,
acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase
         (363 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g11460.1 68416.m01397 pentatricopeptide (PPR) repeat-containi...    29   6.4  

>At3g11460.1 68416.m01397 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 623

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 190 GYNENGMVFSINTLSPLLLKPGNTPRTFITRKLLSAKSFPDAERILRDEG-LGIGNGFSV 248
           GY++NG+ + +  L   +   G  P  F    +LS+ +   A++I  + G L   NGF  
Sbjct: 231 GYSQNGLAYDVLELYEQMKSSGVCPDPFTLVSVLSSCAHLGAKKIGHEVGKLVESNGFVP 290

Query: 249 NM 250
           N+
Sbjct: 291 NV 292


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,710,670
Number of Sequences: 28952
Number of extensions: 370906
Number of successful extensions: 705
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 705
Number of HSP's gapped (non-prelim): 1
length of query: 363
length of database: 12,070,560
effective HSP length: 82
effective length of query: 281
effective length of database: 9,696,496
effective search space: 2724715376
effective search space used: 2724715376
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 60 (28.3 bits)