Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002022-TA|BGIBMGA002022-PA|undefined
         (136 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript...    26   0.51 

>AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1201

 Score = 25.8 bits (54), Expect = 0.51
 Identities = 15/43 (34%), Positives = 17/43 (39%)

Query: 16  TPQPTSWYTSSSRPFYVPKDLRTATHVFLRQGPARRSLQAPYL 58
           T  P SW  SS  P  VP D R      L       + +AP L
Sbjct: 466 THPPVSWPVSSDAPTTVPSDSRVEPQELLSIAAGMVTRKAPGL 508


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.131    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 136,783
Number of Sequences: 2123
Number of extensions: 4967
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 136
length of database: 516,269
effective HSP length: 58
effective length of query: 78
effective length of database: 393,135
effective search space: 30664530
effective search space used: 30664530
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)