BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001858-TA|BGIBMGA001858-PA|IPR013594|Dynein heavy chain, N-terminal region 1 (529 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 1.3 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.0 bits (52), Expect = 1.3 Identities = 19/75 (25%), Positives = 28/75 (37%) Query: 306 RQLSYAGAHHIMDETASQSTRIFEEPIKSDQQKSTAEEVIADITELVGTVEWTIEHIEGE 365 +Q +G H + A FE+ + T E+ ++ LV E I I+ Sbjct: 279 QQRVLSGYHALSGLKAPPGVEHFEDVVHKKCSNFTLPEIQHNLDVLVDMCEQDIIRIDRN 338 Query: 366 IHFPMPDIPALMDEQ 380 F I AL EQ Sbjct: 339 TRFNQDKIVALRQEQ 353 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.136 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,005 Number of Sequences: 317 Number of extensions: 4538 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 1 length of query: 529 length of database: 114,650 effective HSP length: 60 effective length of query: 469 effective length of database: 95,630 effective search space: 44850470 effective search space used: 44850470 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -