BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001854-TA|BGIBMGA001854-PA|undefined (350 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 27 0.27 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 5.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 5.8 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 26.6 bits (56), Expect = 0.27 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 3/109 (2%) Query: 150 YNLKDQ-YQEVYAPRLNYALSVKTVESENNYQGLFSKLT-AVGISVKEAEEIVTTLGEYD 207 ++L+ Q +Q++ A L+ TV S + F LT VGI+ + + T + Sbjct: 32 FSLEHQLWQKIQAWTYLILLTTWTVISASTRIKSFKFLTIGVGITTDTIDRVFTVAIPFV 91 Query: 208 GILSLGPLKDLKMDFVENNFSICELFTKTKNVQSCFHRASDILGCSLYL 256 GI + L K + NNF + KT++ + ++A +L LY+ Sbjct: 92 GIANSCILNQDKWRLLNNNFQQIDKIFKTRDDRVKVYQA-PVLQLFLYI 139 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 279 PGARGIICGGKGTGKSTMLRYL 300 PG I G G GK+T+L L Sbjct: 103 PGELLAILGSSGAGKTTLLNTL 124 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 279 PGARGIICGGKGTGKSTMLRYL 300 PG I G G GK+T+L L Sbjct: 103 PGELLAILGSSGAGKTTLLNTL 124 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.136 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,226 Number of Sequences: 317 Number of extensions: 3407 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 3 length of query: 350 length of database: 114,650 effective HSP length: 57 effective length of query: 293 effective length of database: 96,581 effective search space: 28298233 effective search space used: 28298233 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -