BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001849-TA|BGIBMGA001849-PA|IPR001563|Peptidase S10, serine carboxypeptidase, IPR006195|Aminoacyl-transfer RNA synthetase, class II, IPR002320|Threonyl-tRNA synthetase, class IIa, IPR004154|Anticodon-binding, IPR012676|TGS-like, IPR004095|TGS, IPR012947|Threonyl/alanyl tRNA synthetase, SAD, IPR002314|tRNA synthetase, class II (G, H, P and S) (703 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 4.1 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 7.1 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/48 (20%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Query: 235 HTGKVKALKVTKNSATYWEGKAEAESLQRVYGISFPEPKQLKEWEVIQ 282 H ++ T NS T+ + K ++ ++G + + +WE +Q Sbjct: 1398 HAPQIALTSTTTNSLTF-KLKPHESDVEPIHGYTIHYKPEFGDWETVQ 1444 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.0 bits (47), Expect = 7.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 1 MKEKKKKTEDTNAVSEMNPWP 21 M ++ K+ +T A+S MN WP Sbjct: 10 MTQRCKEKLNTLAISVMNQWP 30 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,595 Number of Sequences: 317 Number of extensions: 7818 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 2 length of query: 703 length of database: 114,650 effective HSP length: 62 effective length of query: 641 effective length of database: 94,996 effective search space: 60892436 effective search space used: 60892436 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -