BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001849-TA|BGIBMGA001849-PA|IPR001563|Peptidase S10, serine carboxypeptidase, IPR006195|Aminoacyl-transfer RNA synthetase, class II, IPR002320|Threonyl-tRNA synthetase, class IIa, IPR004154|Anticodon-binding, IPR012676|TGS-like, IPR004095|TGS, IPR012947|Threonyl/alanyl tRNA synthetase, SAD, IPR002314|tRNA synthetase, class II (G, H, P and S) (703 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 6.8 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 25 9.0 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 25.0 bits (52), Expect = 6.8 Identities = 14/53 (26%), Positives = 22/53 (41%) Query: 283 EEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLVNFIKEQYRSRG 335 +E+ K K+ E+ L E PG+CFF + H F+ + G Sbjct: 49 DESEKLYGGKVQEERVLKAKSESKPGACFFCGQPGHKKRDCKEFLNRESSGEG 101 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 24.6 bits (51), Expect = 9.0 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 597 RQLRV-VPVGPAFDDYAVQVNDKLFAAGFMSEVDTDAGDTLNK 638 RQL V P GP DD+ +++ +AA ++ VD G+ L + Sbjct: 272 RQLNVSFPFGPVPDDFKLRIRQHYYAA--VTFVDELIGELLQE 312 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.136 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 761,169 Number of Sequences: 2123 Number of extensions: 31816 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 50 Number of HSP's gapped (non-prelim): 2 length of query: 703 length of database: 516,269 effective HSP length: 69 effective length of query: 634 effective length of database: 369,782 effective search space: 234441788 effective search space used: 234441788 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -