BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001846-TA|BGIBMGA001846-PA|undefined (379 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 24 1.6 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 22 6.3 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 22 6.3 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Query: 228 ESIQEPILNALKGCLGDIKALACKDNMKSLQTHLLCNTQKL 268 + +QE IL ++ LGDI A ++++L+ C + L Sbjct: 16 KDVQETILQEMRDVLGDIHAKPTYSDLQNLKYLERCIKESL 56 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 22.2 bits (45), Expect = 6.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Query: 325 NSDVVEFIYNDNVIKGNLGCGEVQDKKMSASVGVKTDRPNRI 366 N D+ E + ND + K L C + K +K D P+ + Sbjct: 26 NIDIDEILKNDRLTKNYLDCILEKGKCTPEGEELKKDIPDAL 67 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/30 (30%), Positives = 18/30 (60%) Query: 229 SIQEPILNALKGCLGDIKALACKDNMKSLQ 258 ++QE I+ +K LGD K ++++ L+ Sbjct: 17 TVQEEIVQEMKDVLGDTKKKPVYNDLQELK 46 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.131 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,641 Number of Sequences: 317 Number of extensions: 2607 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 3 length of query: 379 length of database: 114,650 effective HSP length: 58 effective length of query: 321 effective length of database: 96,264 effective search space: 30900744 effective search space used: 30900744 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -